[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : ZK525.1
DDBJ      :             serine\/threonine kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 45->71 FARP_ASCSU 3e-04 63.0 %
:TM
:REPEAT 2|48->58|60->70

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB05022.1 GT:GENE ZK525.1 GT:PRODUCT serine\/threonine kinase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE16731 WP:PRODUCT serine\/threonine kinase WP:LOCUS WBGene00001458 GB:PROTEIN_ID CAB05022.1 LENGTH 87 SQ:AASEQ MQFSTLIRVAVFAVLAIATLADYDDNSVGTIPVAVDLDYFSNYVKKGGPQGPLRFGKRRGPSGPLRFGKRSSFHVAPAAEDVASWYQ BL:SWS:NREP 1 BL:SWS:REP 45->71|FARP_ASCSU|3e-04|63.0|27/161| TM:NTM 1 TM:REGION 3->24| NREPEAT 1 REPEAT 2|48->58|60->70| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHcc //