[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : ZK617.3
DDBJ      :             lipase
Swiss-Prot:SPE17_CAEEL  RecName: Full=Spermatogenesis-defective protein spe-17;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->56 PF04852 * DUF640 0.00045 31.2 48/133  
:BLT:SWISS 1->140 SPE17_CAEEL 4e-72 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA98063.2 GT:GENE ZK617.3 GT:PRODUCT lipase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE28723 WP:PRODUCT lipase WP:LOCUS WBGene00004971 GB:PROTEIN_ID CAA98063.2 LENGTH 140 SQ:AASEQ MADIAKQREQPPRAMSTTSGSDVLKSTTTGTTTGTTKSSVHTSDTNYGVGSLRSDCSEEGFGSNLTPEEANWLNMARVFTKAEKPFKEQKTFRVARKLRTWRPRRSVTWSFLRRLYNGREDMKEDLIRDLADLEIEDKPV SW:ID SPE17_CAEEL SW:DE RecName: Full=Spermatogenesis-defective protein spe-17; SW:GN Name=spe-17; ORFNames=ZK617.3; SW:KW Complete proteome; Developmental protein; Differentiation;Spermatogenesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->140|SPE17_CAEEL|4e-72|100.0|140/142| GO:SWS:NREP 3 GO:SWS GO:0007275|"GO:multicellular organismal development"|Developmental protein| GO:SWS GO:0030154|"GO:cell differentiation"|Differentiation| GO:SWS GO:0007283|"GO:spermatogenesis"|Spermatogenesis| SEG 27->36|tttgtttgtt| HM:PFM:NREP 1 HM:PFM:REP 7->56|PF04852|0.00045|31.2|48/133|DUF640| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-21,32-34,36-39,139-141| PSIPRED ccHHHHHHHccccHHcccccccEEEEccccccccccccccccccccccEEEEEccccHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHHcccccccc //