[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : ZK673.7
DDBJ      :             adenylate kinase
Swiss-Prot:TNNC2_CAEEL  RecName: Full=Troponin C, isoform 2;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
a.39.1
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->159 2jnfA PDBj 5e-33 46.8 %
:RPS:PDB   12->159 1cllA PDBj 1e-19 41.0 %
:RPS:SCOP  12->160 1ij5A  a.39.1.9 * 2e-28 21.2 %
:HMM:SCOP  10->157 1qxpA2 a.39.1.8 * 2.9e-43 44.4 %
:HMM:PFM   20->46 PF00036 * efhand 8.2e-05 29.6 27/29  
:HMM:PFM   55->82 PF00036 * efhand 2.6e-10 50.0 28/29  
:HMM:PFM   96->124 PF00036 * efhand 2.2e-10 41.4 29/29  
:HMM:PFM   132->158 PF00036 * efhand 1.7e-11 44.4 27/29  
:BLT:SWISS 1->160 TNNC2_CAEEL 1e-78 100.0 %
:PROS 64->76|PS00018|EF_HAND_1
:PROS 141->153|PS00018|EF_HAND_1
:REPEAT 2|24->81|101->158
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA88482.1 GT:GENE ZK673.7 GT:PRODUCT adenylate kinase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE01719 WP:PRODUCT adenylate kinase WP:LOCUS WBGene00006583 GB:PROTEIN_ID CAA88482.1 LENGTH 160 SQ:AASEQ MGDVVADALEKLSADQIEQFRKYFNMFDKEGKGYIRATQVGQILRTMGQAFEERDLKQLIKEFDADGSGEIEFEEFAAMVANFVVNNENDEGLEEELREAFRLYDKEGNGYINVSDLRDILRALDDNVSEEELDEMIAEIDADGSGTVDFDEFMEMMSGE SW:ID TNNC2_CAEEL SW:DE RecName: Full=Troponin C, isoform 2; SW:GN Name=tnc-2; ORFNames=ZK673.7; SW:KW Calcium; Complete proteome; Repeat. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->160|TNNC2_CAEEL|1e-78|100.0|160/160| PROS 64->76|PS00018|EF_HAND_1|PDOC00018| PROS 141->153|PS00018|EF_HAND_1|PDOC00018| NREPEAT 1 REPEAT 2|24->81|101->158| SEG 86->99|nnendegleeelre| BL:PDB:NREP 1 BL:PDB:REP 1->159|2jnfA|5e-33|46.8|154/158| RP:PDB:NREP 1 RP:PDB:REP 12->159|1cllA|1e-19|41.0|144/144| HM:PFM:NREP 4 HM:PFM:REP 20->46|PF00036|8.2e-05|29.6|27/29|efhand| HM:PFM:REP 55->82|PF00036|2.6e-10|50.0|28/29|efhand| HM:PFM:REP 96->124|PF00036|2.2e-10|41.4|29/29|efhand| HM:PFM:REP 132->158|PF00036|1.7e-11|44.4|27/29|efhand| RP:SCP:NREP 1 RP:SCP:REP 12->160|1ij5A|2e-28|21.2|137/305|a.39.1.9| HM:SCP:REP 10->157|1qxpA2|2.9e-43|44.4|135/188|a.39.1.8|1/1|EF-hand| OP:NHOMO 2709 OP:NHOMOORG 200 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------11-11-----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 747886D-M9936593333133333323322123233333233323442233334444434341444333422343422244443333-46435553233443A57-5MF*ghWVaKKFCBIPDgdDWHu*Y-cWqAJEDcIMZTCLHC9O6BWFOIJGJJJRkW88LHJaHLU92CCC*67566ijm*2*Q55BCBAU ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 100.0 SQ:SECSTR cccccHcccHHcHHHHHHHHHHHHHHHcTTcccEEcHHHHHHHHHTTTccccHHHHHHHHHHHcTTccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcTTccccccHHHHHHHHHHTTccccHHHHHHHHHHHcccccccccHHHHHHHHHcc DISOP:02AL 1-6| PSIPRED cHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHccccccEEcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccEEcHHHHHHHHHHHcccccHHHHHHHHHHcccccccEEcHHHHHHHHHcc //