[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : ZK892.4
DDBJ      :             L-carnitine dehydratase
Swiss-Prot:YS74_CAEEL   RecName: Full=CaiB/baiF CoA-transferase family protein ZK892.4;         EC=2.-.-.-;

Homologs  Archaea  23/68 : Bacteria  333/915 : Eukaryota  151/199 : Viruses  0/175   --->[See Alignment]
c.123.1
:340 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->326 1x74A PDBj 3e-54 36.6 %
:RPS:PDB   62->176 2c9eA PDBj 1e-29 8.8 %
:RPS:PDB   216->327 1dyoA PDBj 6e-05 10.0 %
:RPS:SCOP  5->313 1xa3A  c.123.1.1 * 4e-64 23.4 %
:HMM:SCOP  1->342 1q7eA_ c.123.1.1 * 5.6e-79 30.5 %
:RPS:PFM   56->246 PF02515 * CoA_transf_3 1e-19 36.0 %
:HMM:PFM   55->246 PF02515 * CoA_transf_3 5.6e-49 33.3 189/191  
:BLT:SWISS 1->340 YS74_CAEEL 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA88571.2 GT:GENE ZK892.4 GT:PRODUCT L-carnitine dehydratase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE32784 WP:PRODUCT L-carnitine dehydratase WP:LOCUS WBGene00014128 GB:PROTEIN_ID CAA88571.2 LENGTH 340 SQ:AASEQ MYRFLSGIKVVEIAGLAPVPHCGMMLADFGADVTVIDKKNPAIEQRLNRGKTMKQLDLKNPEDIKKVRDLCQTSDVLLDPYRPGTLEKMGLDPSTLWNNNKGLIICKISGYGQTGRMSQETGHDINYVALSGMLPTFSGVNATRPWPPANMLADFAGGGLSAAFGILSAIYARSHNGGKGCLLDCSMTEGVAYLSSFVQHYYDQPNLFTDKYALFSGECPIYRTYKTKDDKFVAVGAVEPKFYQNLFKLLNVDGRDLFVNPGKITEDLESRFLQKTRDKWANIFKGQECCVTPVLDIHEVGSYGQHVDRNSFTKTSSNWIANPSPRVWTQDELAALSSKK SW:ID YS74_CAEEL SW:DE RecName: Full=CaiB/baiF CoA-transferase family protein ZK892.4; EC=2.-.-.-; SW:GN ORFNames=ZK892.4; SW:KW Complete proteome; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->340|YS74_CAEEL|0.0|100.0|340/340| GO:SWS:NREP 1 GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 5->326|1x74A|3e-54|36.6|317/354| RP:PDB:NREP 2 RP:PDB:REP 62->176|2c9eA|1e-29|8.8|113/317| RP:PDB:REP 216->327|1dyoA|6e-05|10.0|110/153| RP:PFM:NREP 1 RP:PFM:REP 56->246|PF02515|1e-19|36.0|186/189|CoA_transf_3| HM:PFM:NREP 1 HM:PFM:REP 55->246|PF02515|5.6e-49|33.3|189/191|CoA_transf_3| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02515|IPR003673| GO:PFM GO:0008152|"GO:metabolic process"|PF02515|IPR003673| RP:SCP:NREP 1 RP:SCP:REP 5->313|1xa3A|4e-64|23.4|304/400|c.123.1.1| HM:SCP:REP 1->342|1q7eA_|5.6e-79|30.5|338/417|c.123.1.1|1/1|CoA-transferase family III (CaiB/BaiF)| OP:NHOMO 2182 OP:NHOMOORG 507 OP:PATTERN --1----211311111-11311-41--12-32-----------------------------1-1---- --2251-1---1--5IA33-3B--8L3333349ADB3EKd-G3K1--2----3321-1--11B12196624-111----1616------------------1-------2--------------------------55565---12----------------------------------------22---11----------------1--------22323--------1----------------------2------2-1--11--------------------------------------------------------12------1---1--3-------1--------65------1--------2--5337-----2-IAB--7A488533442443442-34A33D38854-41111222133275462658222426611111111511--623------------------------------56F4-5kUEbECCEHF5456699EE776758R4SOZhY-668474777L8IANP425----11----------622-111-----1---------1----111111-3---------------------------1---1-4-3--1------1----1-11-1----------------2-3--1221111121-111111111111211111-------11--1-------------111211111------------------------1--2111---------------44324242222144543646342455213------------------------------------------111111------------------------------------------------- ----111-----1126575655367773322222224555456333334746B8345224333-1---------1------111-1---3445435311-212432-2-232512221122222232519W3-632222131222112222125-532523212222232C1222-1------11---63---11111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 323 STR:RPRED 95.0 SQ:SECSTR ####TTTcEEEEEcccTHHHHHHHHHHHTTcEEEEEEcTTcccccGGGcccEEEEccTTcHHHHHHHHHHHHHHHHHHTTccTTcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHGHHHTTcTTccccHHHHHHHHHHHHHHHHHTccHHHHHHGGGHcccEEEEEEHHHHHHHHTHHHHHHHHHTTcccccTTTTcccEEEEEccccccTTcEEETTcEEEEEccccccccEEccTcccTTcEEEEEEcTTTccTTcEEEEEcccccccEEEEEEEEEcTTccEEEEEEEEEEcccccEEEEEEEEE############# DISOP:02AL 332-340| PSIPRED ccccccccEEEHHHHHHHHHHHHHHHHHHccEEEEEcccccccHHHHccccEEEEEEcccHHHHHHHHHHHHHccEEEEcccHHHHHHHcccHHHHHHHcccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHccccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEcccccEEEEEEccHHHHHHHHHHHccccHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHccccEEEcccHHHHHcccHHHHccEEEEEcccEEcccccccccccccccccccc //