[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halobacterium sp. NRC-1 (halo0)
Gene : AAG19332.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:51 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAG19332.1 GT:GENE AAG19332.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00041CH01 GT:ORG halo0 GB:ACCESSION GIB00041CH01 GB:LOCATION 678467..678622 GB:FROM 678467 GB:TO 678622 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Vng0892h GB:PROTEIN_ID AAG19332.1 GB:DB_XREF GI:10580456 LENGTH 51 SQ:AASEQ MPSGLVALVLGALVSVTVLSFGAYIGALRALDVYFSDQDSVFLSDDAGPRE GT:EXON 1|1-51:0| TM:NTM 1 TM:REGION 10->32| SEG 3->20|sglvalvlgalvsvtvls| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------11----------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 47-51| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccEEEcccccccc //