[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halobacterium sp. NRC-1 (halo0)
Gene : AAG19916.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->57 PF01925 * TauE 0.00021 15.1 53/239  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAG19916.1 GT:GENE AAG19916.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00041CH01 GT:ORG halo0 GB:ACCESSION GIB00041CH01 GB:LOCATION 1240710..1240901 GB:FROM 1240710 GB:TO 1240901 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Vng1664h GB:PROTEIN_ID AAG19916.1 GB:DB_XREF GI:10581134 LENGTH 63 SQ:AASEQ MRFDFTRAVGLLAAFVAVGMIGLSAADVMPARVMFMMVLPSMIVFAAISFLIGMKHGEHRITG GT:EXON 1|1-63:0| TM:NTM 2 TM:REGION 5->27| TM:REGION 33->55| SEG 8->19|avgllaafvavg| HM:PFM:NREP 1 HM:PFM:REP 4->57|PF01925|0.00021|15.1|53/239|TauE| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------11----------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 58-63| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //