[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halobacterium sp. NRC-1 (halo0)
Gene : AAG19928.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:163 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->31 PF04758 * Ribosomal_S30 0.00071 52.4 21/59  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAG19928.1 GT:GENE AAG19928.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00041CH01 GT:ORG halo0 GB:ACCESSION GIB00041CH01 GB:LOCATION complement(1250640..1251131) GB:FROM 1250640 GB:TO 1251131 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Vng1679h GB:PROTEIN_ID AAG19928.1 GB:DB_XREF GI:10581148 LENGTH 163 SQ:AASEQ MQRKPVPPAPSSLAAVGDVRDATPLVPKPEDDCCRRLIERAGVEDRGTASAWLVFLSAVGVLVDDDAGYARRGDVGVDDREALAAGFRENVFLGGDVVDALDDTPAQPRDVFDAVREQVPPWERAKRDNWQAFWTGRVRRRLDWAALFGQAVRVDDTPCYRRA GT:EXON 1|1-163:0| SEG 5->16|pvppapsslaav| HM:PFM:NREP 1 HM:PFM:REP 11->31|PF04758|0.00071|52.4|21/59|Ribosomal_S30| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------------1111--1------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 162-163| PSIPRED ccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHEEcccccEEccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //