[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halobacterium sp. NRC-1 (halo0)
Gene : AAG20441.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:261 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAG20441.1 GT:GENE AAG20441.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00041CH01 GT:ORG halo0 GB:ACCESSION GIB00041CH01 GB:LOCATION 1744977..1745762 GB:FROM 1744977 GB:TO 1745762 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Vng2335h GB:PROTEIN_ID AAG20441.1 GB:DB_XREF GI:10581747 LENGTH 261 SQ:AASEQ MLYCSGGPGWHGDYDGNRARSGVQPRGSQPASTGAPGVRVILRSGQRRSGCTRATGRQDASIGLEPPTWGLAPSRAWRTRLRPTASHKPIPTIQNGPTGGRTRAVVRTDDGWTRRPPSTPKAGSHPPAGVLCAGGSDGHLQAGVQTTSMSDLTPEEFEEQKYVDYFPKLETAYKRAFDDMNGTYDRKLVHAIDQQVLSESEPFYEADSGFSVELPADPLDRLAGVQVDADHARDVIDEHTDRICVHLRDQFGIGGQADEKA GT:EXON 1|1-261:0| OP:NHOMO 11 OP:NHOMOORG 8 OP:PATTERN ------------------------21122111------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 19-34, 115-124, 256-261| PSIPRED cEEccccccccccccccHHHccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccEEEEEEccccccccccccccccccccccEEEEccccccEEccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccEEEccccEEEEccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //