[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halobacterium sp. NRC-1 (halo0)
Gene : cna
DDBJ      :cna          proliferating-cell nucleolar antigen
Swiss-Prot:             

Homologs  Archaea  44/68 : Bacteria  591/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->299 1ixkA PDBj 1e-25 32.2 %
:RPS:PDB   12->300 2as0A PDBj 7e-16 10.6 %
:RPS:SCOP  12->300 1ixkA  c.66.1.38 * 6e-58 30.3 %
:HMM:SCOP  11->302 1ixkA_ c.66.1.38 * 5.1e-58 33.7 %
:RPS:PFM   78->299 PF01189 * Nol1_Nop2_Fmu 5e-32 41.5 %
:HMM:PFM   20->299 PF01189 * Nol1_Nop2_Fmu 1.6e-47 31.9 270/283  
:BLT:SWISS 13->299 RSMF_VIBPA 1e-28 32.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAG19031.1 GT:GENE cna GT:PRODUCT proliferating-cell nucleolar antigen GT:DATABASE GIB00041CH01 GT:ORG halo0 GB:ACCESSION GIB00041CH01 GB:LOCATION complement(385002..385913) GB:FROM 385002 GB:TO 385913 GB:DIRECTION - GB:GENE cna GB:PRODUCT proliferating-cell nucleolar antigen GB:NOTE Cna GB:PROTEIN_ID AAG19031.1 GB:DB_XREF GI:10580101 GB:GENE:GENE cna LENGTH 303 SQ:AASEQ MDALSRYEPIIDDFEGFLAACERPLPTTVRVNPLAVTPDRAVEALAAEGVAVDRREWHPGVLEVDTNKPGNTWPYVHGWVHGQEEVSCVPPRVLDPEPGDVVWDACAAPGGKTAQIAAEIDDDGLVVANDDNLGRLSALRGNCDRLGVTSAAVTNTDARRATLDAFPDVAAVDAALVDAPCSCEGTIRKNADALDGAGASASRSLGRLQADILARAVALTRPGGTVVYSTCTFAPEENEAVVDEVLGRTDSRLVEFDVGLASAPGLTEWGDASYDDSLARAQRYYPHHNDTGGFFAAKLEVTA GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 13->299|RSMF_VIBPA|1e-28|32.1|277/478| SEG 41->52|avealaaegvav| SEG 163->180|ldafpdvaavdaalvdap| SEG 191->208|adaldgagasasrslgrl| BL:PDB:NREP 1 BL:PDB:REP 18->299|1ixkA|1e-25|32.2|261/298| RP:PDB:NREP 1 RP:PDB:REP 12->300|2as0A|7e-16|10.6|255/382| RP:PFM:NREP 1 RP:PFM:REP 78->299|PF01189|5e-32|41.5|205/229|Nol1_Nop2_Fmu| HM:PFM:NREP 1 HM:PFM:REP 20->299|PF01189|1.6e-47|31.9|270/283|Nol1_Nop2_Fmu| RP:SCP:NREP 1 RP:SCP:REP 12->300|1ixkA|6e-58|30.3|274/305|c.66.1.38| HM:SCP:REP 11->302|1ixkA_|5.1e-58|33.7|285/0|c.66.1.38|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1446 OP:NHOMOORG 831 OP:PATTERN 11-1252111111112-1-----311111111---11111111-----1----75554444---11-- -1--------------------------------------------------------------------------------------1111-111-----11--12-----------------11111111--21--------1-11121111-11111111112-1111111111111111---1111-2211111111111111111111111112221111111111231111111111111111--1111222222122222222122121---2222222111222222222222222222222222222222222121111111111111122111111212112221111121111212222-1-1-1111111-11--1111211111111111111111-1111121111112111112--121331-1111-11-111222222221-1-1211------------------------------11111-111-2222211222211--222221121111112221--11111111111-11121111211111-22221111-111--11---1111121-1----2-11----------------------11-1133211-1-1224544434444444443444--1121-------22211222222222222-2222222222222222222222221112222222222222222222221221-111111111111---11111111111--111111--1111-1--11----------2-111111111111--11---------122222222222233----------11111-2--------------------------1--------1----------111-111--1 113332316352123221-111111121111111122222122111121222121122111122222212232221222222222231-11222122222212222335362332451112222731329Q5-43C1222532432221121132423223523322212814342124Q6541214512323334331 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 302 STR:RPRED 99.7 SQ:SECSTR HHTTTTcccHHTTHHHHHHHHHHcTTccEEEEEEccHHHHHTTcccEEEEEEEccccEHHHEEEEETTEEEEEEcccccccccTTHHHHHHHGGGccTTcEEEETTcTTTHHHHHHHHHHTTccEEEEEEccHHHHHHHHHHHHHTTcGGGEEEEccHHHHHHHHHTTccEEEEEEccccccccGGGHHHEEEEccccccccHHHHHHHHHHHHHHHTTEEEEEEEEEEEccTTccHHHHHHHHHHTTcTTTEEEccHHHHHHTTEEEEccccccccTTccccTcGGGcccEEEEEEEEEEc# DISOP:02AL 302-304| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHcccEEEEccccccEEEEccccccccHHHHccEEEEEccHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccEEEEEEcccccccHHHccccccEEEEEEccccccccEEccccHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHHHHcccEEEEcccccccccccccccccccccccccEEEEccccccccEEEEEEEEEcc //