[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halobacterium sp. NRC-1 (halo0)
Gene : hisB
DDBJ      :hisB         imidazoleglycerol-phosphate dehydratase
Swiss-Prot:HIS7_HALSA   RecName: Full=Imidazoleglycerol-phosphate dehydratase;         Short=IGPD;         EC=4.2.1.19;

Homologs  Archaea  53/68 : Bacteria  711/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->184 2f1dA PDBj 2e-32 40.9 %
:RPS:PDB   23->180 2ae8F PDBj 2e-28 28.9 %
:RPS:SCOP  24->88 2ae8A1  d.14.1.9 * 3e-21 34.4 %
:RPS:SCOP  89->179 1rhyA2  d.14.1.9 * 8e-08 33.0 %
:HMM:SCOP  3->88 2f1dA1 d.14.1.9 * 5.5e-36 59.3 %
:HMM:SCOP  89->181 1rhyA2 d.14.1.9 * 1.2e-27 43.0 %
:RPS:PFM   33->175 PF00475 * IGPD 8e-30 50.3 %
:HMM:PFM   33->175 PF00475 * IGPD 2.1e-61 52.4 143/145  
:BLT:SWISS 21->196 HIS7_HALSA 3e-93 100.0 %
:PROS 63->76|PS00954|IGP_DEHYDRATASE_1
:PROS 157->169|PS00955|IGP_DEHYDRATASE_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAG20408.1 GT:GENE hisB GT:PRODUCT imidazoleglycerol-phosphate dehydratase GT:DATABASE GIB00041CH01 GT:ORG halo0 GB:ACCESSION GIB00041CH01 GB:LOCATION 1711756..1712346 GB:FROM 1711756 GB:TO 1712346 GB:DIRECTION + GB:GENE hisB GB:PRODUCT imidazoleglycerol-phosphate dehydratase GB:NOTE HisB GB:PROTEIN_ID AAG20408.1 GB:DB_XREF GI:10581707 GB:GENE:GENE hisB LENGTH 196 SQ:AASEQ MTDRTAAVTRETAETDVAVTLDLDGDGEHTVDTGIGFFDHMLAAFAKHGLFDVTVRCDGDLDVDDHHTVEDVGIALGAAFSEAVGEKRGIQRFADRRVPLDEAVASVVVDVSGRAVYEFDGGFSQPTVGGLTSRMAAHFWRTFATHAAVTLHCGVDGENAHHEIEALFKGVGRAVDDATRIDQRRAGETPSTKGDL GT:EXON 1|1-196:0| SW:ID HIS7_HALSA SW:DE RecName: Full=Imidazoleglycerol-phosphate dehydratase; Short=IGPD; EC=4.2.1.19; SW:GN Name=hisB; OrderedLocusNames=VNG_2295G; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 21->196|HIS7_HALSA|3e-93|100.0|176/196| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| PROS 63->76|PS00954|IGP_DEHYDRATASE_1|PDOC00738| PROS 157->169|PS00955|IGP_DEHYDRATASE_2|PDOC00738| SEG 2->20|tdrtaavtretaetdvavt| SEG 103->116|avasvvvdvsgrav| BL:PDB:NREP 1 BL:PDB:REP 21->184|2f1dA|2e-32|40.9|164/183| RP:PDB:NREP 1 RP:PDB:REP 23->180|2ae8F|2e-28|28.9|149/165| RP:PFM:NREP 1 RP:PFM:REP 33->175|PF00475|8e-30|50.3|143/145|IGPD| HM:PFM:NREP 1 HM:PFM:REP 33->175|PF00475|2.1e-61|52.4|143/145|IGPD| GO:PFM:NREP 2 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF00475|IPR000807| GO:PFM GO:0004424|"GO:imidazoleglycerol-phosphate dehydratase activity"|PF00475|IPR000807| RP:SCP:NREP 2 RP:SCP:REP 24->88|2ae8A1|3e-21|34.4|61/76|d.14.1.9| RP:SCP:REP 89->179|1rhyA2|8e-08|33.0|91/94|d.14.1.9| HM:SCP:REP 3->88|2f1dA1|5.5e-36|59.3|86/0|d.14.1.9|1/2|Ribosomal protein S5 domain 2-like| HM:SCP:REP 89->181|1rhyA2|1.2e-27|43.0|93/0|d.14.1.9|2/2|Ribosomal protein S5 domain 2-like| OP:NHOMO 904 OP:NHOMOORG 881 OP:PATTERN ---1--1111111111-1111111111111111111111111111111211111-1--11------11 1111111111111111111-11111111111111111111121111111111111111--111111111111111111--11111111111111-----1-111111111---------------111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111-1----11-1---11--11----1-111-------111------------------------1----1----11-1111111-1-1111111---1-1--1111111111111111111--11111111-----111111111111111111111111-11111111111-1111111111111111111111111111111111111111111-----------------------------11111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111-1111111111111111111111111111-1-------11111111111111111111111111111111111111--111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1-----111111111111111-1111---1111111111111111111111111111111--------111111111111111111111111111111111111111-----------------------------------------1-111111 ------1-----221-111111112111111-1111-1111111111111111111111111111111111111-111--11111111-12111111111111111-11-------------------------------------------------1----2-1-------1-11118111-111131312112111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 164 STR:RPRED 83.7 SQ:SECSTR ####################EEEccccccEEEcccHHHHHHHHHHHHHHccEEEEEEEccTccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEETTEEEEEEEEcccccEEEEEccccccEETTEETHHHHHHHHHHHHHTTcEEEEEEEcccHHHHHHHHHHHHHHHHHHHHccccc############ DISOP:02AL 1-3| PSIPRED ccccEEEEEEEEcEEEEEEEEEEccccEEEEEccccHHHHHHHHHHHHccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHccccccEEEEEEEEEcHHHcEEEEEEEEcccEEEEEEccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEccHHHHHHHHHHHHHHHHHHcccccccccccccccccc //