[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halobacterium sp. NRC-1 (halo0)
Gene : phr1
DDBJ      :phr1         photolyase/cryptochrome
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  472/915 : Eukaryota  140/199 : Viruses  0/175   --->[See Alignment]
a.99.1c.28.1
:462 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->438 1tezA PDBj 2e-61 36.6 %
:RPS:PDB   2->457 1dnpA PDBj 1e-75 29.1 %
:RPS:SCOP  3->148 1u3cA2  c.28.1.1 * 3e-18 21.9 %
:RPS:SCOP  183->454 1u3cA1  a.99.1.1 * 3e-73 29.3 %
:HMM:SCOP  1->200 1owlA2 c.28.1.1 * 5.6e-36 31.6 %
:HMM:SCOP  175->454 1np7A1 a.99.1.1 * 2.8e-93 44.5 %
:RPS:PFM   3->129 PF00875 * DNA_photolyase 7e-16 43.3 %
:RPS:PFM   185->422 PF03441 * FAD_binding_7 6e-44 46.1 %
:HMM:PFM   185->455 PF03441 * FAD_binding_7 1.1e-86 43.7 263/277  
:HMM:PFM   3->158 PF00875 * DNA_photolyase 2.1e-38 37.0 154/166  
:BLT:SWISS 1->457 PHR_HALSA 2e-83 44.8 %
:PROS 194->205|PS00136|SUBTILASE_ASP
:PROS 310->322|PS00394|DNA_PHOTOLYASES_1_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAG19981.1 GT:GENE phr1 GT:PRODUCT photolyase/cryptochrome GT:DATABASE GIB00041CH01 GT:ORG halo0 GB:ACCESSION GIB00041CH01 GB:LOCATION complement(1293457..1294845) GB:FROM 1293457 GB:TO 1294845 GB:DIRECTION - GB:GENE phr1 GB:PRODUCT photolyase/cryptochrome GB:NOTE Phr1 GB:PROTEIN_ID AAG19981.1 GB:DB_XREF GI:10581208 GB:GENE:GENE phr1 LENGTH 462 SQ:AASEQ MHLYWHQRDLRVPDNRGLHAATDGDTVVPVYVFDDTVLSQVGRPKRAFLAAGVRALRAAYRERGSDLLVREGDAESVLPALADEFDADTVFHAAHYDAARRNRRTRVADALAAAGVDTAGHVDHTLVDPATLDDAYPSHSQFYDDWQQAPKPDPVPAPDADALADVHDDHTLSVPAPEPPLPDAGHAAATDRLAAFLDDGIASYNDTRDDLAAAVDAPASAVSRLSPYLAAGNIGVREVWAAVADAYDDATGNAARNIGKYRYELSWREQNYHLLYHTPRLQTENYVSFDAPIAWQNSDDHFEAWTRGETGYPLVDAGMRQLRAEGYVHNRPRQVVASFLTKHLLVDWRRGERHFADRLVDYDPANNAANWQWTASTGTDTVAVRIFDPVSQMAKYDSDAAFVTEYVPELRGVDPETIVDWPTLRHSQRERLAPDYHHPIVDRDHAYERAQRVFEAALDGDA GT:EXON 1|1-462:0| BL:SWS:NREP 1 BL:SWS:REP 1->457|PHR_HALSA|2e-83|44.8|451/481| PROS 194->205|PS00136|SUBTILASE_ASP|PDOC00125| PROS 310->322|PS00394|DNA_PHOTOLYASES_1_1|PDOC00331| SEG 104->120|rtrvadalaaagvdtag| SEG 149->170|apkpdpvpapdadaladvhddh| SEG 209->223|ddlaaavdapasavs| SEG 241->250|aavadaydda| BL:PDB:NREP 1 BL:PDB:REP 3->438|1tezA|2e-61|36.6|429/474| RP:PDB:NREP 1 RP:PDB:REP 2->457|1dnpA|1e-75|29.1|444/469| RP:PFM:NREP 2 RP:PFM:REP 3->129|PF00875|7e-16|43.3|127/168|DNA_photolyase| RP:PFM:REP 185->422|PF03441|6e-44|46.1|230/252|FAD_binding_7| HM:PFM:NREP 2 HM:PFM:REP 185->455|PF03441|1.1e-86|43.7|263/277|FAD_binding_7| HM:PFM:REP 3->158|PF00875|2.1e-38|37.0|154/166|DNA_photolyase| GO:PFM:NREP 4 GO:PFM GO:0003913|"GO:DNA photolyase activity"|PF00875|IPR006050| GO:PFM GO:0006281|"GO:DNA repair"|PF00875|IPR006050| GO:PFM GO:0003913|"GO:DNA photolyase activity"|PF03441|IPR005101| GO:PFM GO:0006281|"GO:DNA repair"|PF03441|IPR005101| RP:SCP:NREP 2 RP:SCP:REP 3->148|1u3cA2|3e-18|21.9|146/185|c.28.1.1| RP:SCP:REP 183->454|1u3cA1|3e-73|29.3|266/300|a.99.1.1| HM:SCP:REP 1->200|1owlA2|5.6e-36|31.6|193/0|c.28.1.1|1/1|Cryptochrome/photolyase, N-terminal domain| HM:SCP:REP 175->454|1np7A1|2.8e-93|44.5|272/279|a.99.1.1|1/1|Cryptochrome/photolyase FAD-binding domain| OP:NHOMO 1028 OP:NHOMOORG 632 OP:PATTERN ------1111111111--------32233223-----------------1-----------1------ ---11-11111----11----1--11-----11111111111-12----1111111-1----1-1-11211-------------------------1----132212232--------------1---1-----1122322---1112212222222223222222322321--1122-21-2---111---1-1111111--111111----1-11------221111111--11111111111111-111-1-------------------11-------1-----------------1111111111111-------------------------------------------------------------11111-------1121--111111----------1----------111-111-1-111--1112132-1111211111111112111--11--------1--1--11-------------121-111----11111111111221111111111111111111-3111111-11-111-1221111-1111----111-------------------------------1-------------------11-----111231123231111112-111111--1-1----111-1-111-1111111111111111-111111111111111111111111--111111111111111111111111111111111111111--1111-111111-1212---------------11111-111111111111111111111112111-22-11111-33333322111111111111------1---------------------------1---------------1-1--------1- ------2-421----44431112-211------111----------22333333333--222-11-11----1--111112--------111411----3224111--926B766932-21121332214D21223212-21232222222212283461---24413341--847444O4234555774655633434 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 457 STR:RPRED 98.9 SQ:SECSTR #EEEEcccccccTTcHHHHHHccTcEEEEEEEEcHHHHTTccHHHHHHHHHHHHHHHHHHHHTTccEEEEEccHHHHHHHHHHHHTccEEEEEccccHHHHHHHHHHHHHHHcTTcEEEEEcccccccTTccccccccHHHHHHHHHHHHHTccccccccccccTTccccccccccccTTTccccHHHHHHHHHHHHHTHHHHHHHHTTcccccTcTTcccccccHHHHHHTcccHHHHHHHHHHHcGGGGGTcTTHcHHHHHHHHHHHHHHHHHHHcGGGGGTccccGGGGccccccHHHHHHHHHTccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHTccccHHHHHHHHHTTcTTccHHHHHHHHHHHTTccTTccTTccccHHHHHHHHTTTcHHHHHHcGGGTTccTTGGGcHHHHHHTTTTTcccccccccccHHHHHHHHHHHHHHHH#### DISOP:02AL 251-252, 460-462| PSIPRED cEEEEEcccccccccHHHHHHHccccEEEEEEEccHHHccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEcccEEEccHHHccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHcccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccEEEEcHHHHHHHHcccHHHHHHHHHHHHcccHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccc //