[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM55756.1
DDBJ      :             2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  484/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->168 1wa3D PDBj 8e-30 37.8 %
:RPS:PDB   20->147 3cwnA PDBj 3e-07 14.1 %
:RPS:SCOP  2->207 1euaA  c.1.10.1 * 2e-41 31.2 %
:HMM:SCOP  1->209 1euaA_ c.1.10.1 * 2.9e-62 42.8 %
:RPS:PFM   8->196 PF01081 * Aldolase 9e-37 46.8 %
:HMM:PFM   8->198 PF01081 * Aldolase 1.7e-44 32.1 190/196  
:BLT:SWISS 6->205 ALKH_SHIFL 2e-24 32.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM55756.1 GT:GENE ACM55756.1 GT:PRODUCT 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION complement(160558..161202) GB:FROM 160558 GB:TO 161202 GB:DIRECTION - GB:PRODUCT 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase GB:NOTE TIGRFAM: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and KHG aldolase; KEGG: hwa:HQ1495A KHG/KDPG aldolase (4-hydroxy-2-oxoglutarate aldolase; 2-dehydro-3-deoxy-phosphogluconate aldolase) GB:PROTEIN_ID ACM55756.1 GB:DB_XREF GI:222451491 InterPro:IPR000887 LENGTH 214 SQ:AASEQ MNETLSRLVDSGVVAVLRGVEADQLIEITEALRDGGVTAVEITADTPNVAEKLSEVAGSFDDEVVVGTGTVLDSETARTTLMAGAEFVVSPSLHEDVIETCNRYGAVSAPGVMTPTEAIRGYEAGADFVKVFPAKTVGPAHLGAMKGPLGQIPMMPTGGVGPDNAADYIDAGAFAVGAGGALVDYDAAARGDYESITETARQFVQVVEDARGDD GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 6->205|ALKH_SHIFL|2e-24|32.7|199/213| SEG 171->181|agafavgagga| BL:PDB:NREP 1 BL:PDB:REP 13->168|1wa3D|8e-30|37.8|156/203| RP:PDB:NREP 1 RP:PDB:REP 20->147|3cwnA|3e-07|14.1|128/316| RP:PFM:NREP 1 RP:PFM:REP 8->196|PF01081|9e-37|46.8|188/194|Aldolase| HM:PFM:NREP 1 HM:PFM:REP 8->198|PF01081|1.7e-44|32.1|190/196|Aldolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01081|IPR000887| GO:PFM GO:0008152|"GO:metabolic process"|PF01081|IPR000887| RP:SCP:NREP 1 RP:SCP:REP 2->207|1euaA|2e-41|31.2|205/213|c.1.10.1| HM:SCP:REP 1->209|1euaA_|2.9e-62|42.8|208/0|c.1.10.1|1/1|Aldolase| OP:NHOMO 767 OP:NHOMOORG 504 OP:PATTERN ------------------------1--1112------------------------------------- 1-1-2-----1--------------3------------341--2211-1---122--1-----1113141--------2---1-----111111-----1-2-211-2-1-----------------------------------1111111-1111-1----11111111------------22-1111-1-1-------1-------212211----13-2-----1---2------------------113-1-22-----1---23------1112122222---111111211111111111211111-22---222211-231111111-1-21--11111--1--1------------124-1------2222-11-131212--------22222222122-1121121222--222222222122212112232233222--------21111---------------------------------11221----12222222222222222222222221111--2221-11111242211--1111-1111111-----------------------------------2-----------1-1-1111111-------1142111-3221211111111111111111-------------22111212112233222-12224232221323323333232111221222122212-111231111111--111111111111----1111111111-123111312-111--1111111111---4122221122111112222----------2244111111323522222221221111------------------11----1------1-------------------111-1-1- ------1-----------------------------------------------------------------------------------------------------4------------------------------------------------------2-----------1--11111--2--1--111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 96.7 SQ:SECSTR ##HHHHHHHcccEEEEcccTcHHHHHHHHHHHHHHHHHTTGEEEEEEccHHHHHHHHHHHHTTccEEEEEEccHHHHHHHHHTTccccHHHHHHHHHHcccccccGGGcHHHHHHHHHHHHHHHTTcccEEEEcccccHHHHHHTTTTTcccTTEEEccccTTTHHHHHHTTccEEEcTHHHHcccEEEETcHHHHHHHHHHHHHTccc##### DISOP:02AL 214-215| PSIPRED cHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccEEEcccccHHHHHHHHHcccEEEcccccHHHHHHHHHccccEEEEccHHHccHHHHHHHHHHcccccEEEEccccHHHHHHHHHccccEEEEcHHHccHHHHHcccHHHHHHHHHHHHHHHHHHcccc //