[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM55910.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:239 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM55910.1 GT:GENE ACM55910.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION complement(328605..329324) GB:FROM 328605 GB:TO 329324 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: hsl:OE1403F hypothetical protein GB:PROTEIN_ID ACM55910.1 GB:DB_XREF GI:222451645 LENGTH 239 SQ:AASEQ MTRTNDDEPPEWAKEQAREMMAAEEPSDDEETEKGDGGETEEGDGERDADADDDRVPDVPADTVDEAERLTRLARRTEDEAAAAFYRERRDELVTDHDYVPRLREEDDTLVLYPDEWMDDGTVQLDRIETTDRAVEVSLSGPGDAGRYREIAAYNDAVADAVADAHDAVHADTARSFAAFMSNHYVRAVDDATADMRAEFREEYFPRNGWPTDEQLAVVDESLDAIESVAADVDGPEES GT:EXON 1|1-239:0| SEG 28->65|ddeetekgdggeteegdgerdadadddrvpdvpadtvd| SEG 152->174|aayndavadavadahdavhadta| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN ------------------------1111-111------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,39-39| PSIPRED ccccccccccHHHHHHHHHHHHccccccHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccccEEEEcccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccc //