[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM56284.1
DDBJ      :             chaperone protein DnaK
Swiss-Prot:DNAK_HALLT   RecName: Full=Chaperone protein dnaK;AltName: Full=Heat shock protein 70;AltName: Full=Heat shock 70 kDa protein;AltName: Full=HSP70;

Homologs  Archaea  27/68 : Bacteria  912/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
a.8.4b.130.1c.55.1d.24.1
:644 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->489 2v7yA PDBj e-163 63.1 %
:RPS:PDB   4->489 3c7nB PDBj e-103 48.1 %
:RPS:SCOP  5->158 1jceA1  c.55.1.1 * 1e-39 25.0 %
:RPS:SCOP  217->372 2retB1  d.24.1.5 * 2e-36 10.2 %
:RPS:SCOP  362->489 3c7nB1  b.130.1.1 * 2e-40 56.2 %
:HMM:SCOP  3->163 1hjoA1 c.55.1.1 * 1.4e-55 56.2 %
:HMM:SCOP  164->357 1dkgD2 c.55.1.1 * 3.2e-65 53.1 %
:HMM:SCOP  357->514 1ckrA_ b.130.1.1 * 7.6e-57 60.1 %
:HMM:SCOP  481->595 1u00A1 a.8.4.1 * 1e-11 35.7 %
:RPS:PFM   8->468 PF00012 * HSP70 e-130 60.4 %
:HMM:PFM   6->78 PF00012 * HSP70 5.1e-32 63.9 72/602  
:HMM:PFM   82->581 PF00012 * HSP70 5.3e-214 58.4 497/602  
:BLT:SWISS 1->581 DNAK_HALLT 0.0 100.0 %
:PROS 9->16|PS00297|HSP70_1
:PROS 170->183|PS00329|HSP70_2
:PROS 311->325|PS01036|HSP70_3
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM56284.1 GT:GENE ACM56284.1 GT:PRODUCT chaperone protein DnaK GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION complement(699445..701379) GB:FROM 699445 GB:TO 701379 GB:DIRECTION - GB:PRODUCT chaperone protein DnaK GB:NOTE TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein 70; KEGG: nph:NP0218A DnaK-type molecular chaperone HSP70 GB:PROTEIN_ID ACM56284.1 GB:DB_XREF GI:222452019 InterPro:IPR001023 InterPro:IPR012725 InterPro:IPR013126 LENGTH 644 SQ:AASEQ MASNKILGIDLGTTNSAFAVMEGDEPEIIANAEGDRTTPSVVAFADDGERLVGKPAKNQAVQNPDRTIQSIKRHMGEDGYTVEIGDEEYTPEQVSAMILQKIKRDAEEYLGDDVEKAVITVPAYFNDKQRQATKDAGEIAGFEVERIVNEPTAASMAYGLDDESDQTVLVYDLGGGTFDVSVLDLGGGVYEVVATNGDNDLGGDDWDEALIDHLAKEFKNNHGIDLREDRQALQRLKDAAEEAKIELSSKKETTVNLPFITATDSGPVHLEQSITRATFENLTSDLIERTVNPTEQALSDADYSKSDIDEVILVGGSTRMPQVQEQVEALVGQEPKKNVNPDEAVALGAAVQGGVLSGDVDDIVLLDVTPLSLGIEVKGGLFERLIEKNTTIPTEESKVFTTAADNQTSVNVRVFQGEREIAEENELLGAFQLSGIPPAPAGTPQIEVSFNIDENGIVNVEAEDQGSGNAESITIEGGVGLSDEEIDQMQEEAEKHKEEDEARRERIEARNEAETSIQRAETLLEENEEELDDDELVADIEAAIEDVEEVLEDEDADTDEIESATEALTEELQEIGKQMYEGQAAQAGPGGAGGAAGAGPGGMGGMGGAAGPGGAGGAGPGGADADDEEYVDADFEDVDDEDDA GT:EXON 1|1-644:0| SW:ID DNAK_HALLT SW:DE RecName: Full=Chaperone protein dnaK;AltName: Full=Heat shock protein 70;AltName: Full=Heat shock 70 kDa protein;AltName: Full=HSP70; SW:GN Name=dnaK; OrderedLocusNames=Hlac_0682; SW:KW ATP-binding; Chaperone; Complete proteome; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->581|DNAK_HALLT|0.0|100.0|581/644| GO:SWS:NREP 2 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 9->16|PS00297|HSP70_1|PDOC00269| PROS 170->183|PS00329|HSP70_2|PDOC00269| PROS 311->325|PS01036|HSP70_3|PDOC00269| COIL:NAA 68 COIL:NSEG 2 COIL:REGION 225->257| COIL:REGION 494->528| SEG 196->207|ngdndlggddwd| SEG 344->358|avalgaavqggvlsg| SEG 491->514|eeaekhkeedearreriearneae| SEG 520->560|aetlleeneeeldddelvadieaaiedveevlededadtde| SEG 582->643|gqaaqagpggaggaagagpggmggmggaagpggaggagpggadaddeeyvdadfedvddedd| BL:PDB:NREP 1 BL:PDB:REP 4->489|2v7yA|e-163|63.1|483/504| RP:PDB:NREP 1 RP:PDB:REP 4->489|3c7nB|e-103|48.1|480/540| RP:PFM:NREP 1 RP:PFM:REP 8->468|PF00012|e-130|60.4|454/488|HSP70| HM:PFM:NREP 2 HM:PFM:REP 6->78|PF00012|5.1e-32|63.9|72/602|HSP70| HM:PFM:REP 82->581|PF00012|5.3e-214|58.4|497/602|HSP70| RP:SCP:NREP 3 RP:SCP:REP 5->158|1jceA1|1e-39|25.0|136/137|c.55.1.1| RP:SCP:REP 217->372|2retB1|2e-36|10.2|147/159|d.24.1.5| RP:SCP:REP 362->489|3c7nB1|2e-40|56.2|128/154|b.130.1.1| HM:SCP:REP 3->163|1hjoA1|1.4e-55|56.2|160/0|c.55.1.1|1/1|Actin-like ATPase domain| HM:SCP:REP 164->357|1dkgD2|3.2e-65|53.1|194/0|c.55.1.1|1/1|Actin-like ATPase domain| HM:SCP:REP 357->514|1ckrA_|7.6e-57|60.1|158/159|b.130.1.1|1/1|Heat shock protein 70kD (HSP70), peptide-binding domain| HM:SCP:REP 481->595|1u00A1|1e-11|35.7|112/0|a.8.4.1|1/1|Heat shock protein 70kD (HSP70), C-terminal subdomain| OP:NHOMO 4402 OP:NHOMOORG 1137 OP:PATTERN ------------------------11121111111-------12211211212--------111--11 2241311222221112211-111121111112111122722A6A11111111321121112221338323111111111232121221332221221112212221222311111111111111122232222233323221113254745543444333432444175652332222322331111111231222222122121111132222212211112222222232311111111111111111111122222212121133222212221111111111111111111111111111111111111111111111134352222222242312AA42221221112211223215221132221241121113111111112221112112111111111111221232221211211211211111221211111111111222222222222232222222222222222122222222223333112321322224444444333344743334344573443334453243355333244423224222322221113342233132112122222122113139999C625111222111121212222222122222344211312222222222222222222224111212222222224222213343323232-33433223223233333332222322232323233333232222332223311222222222222111222222111122222222322222222222222321333332333344543333334441111111112443422222222223222222222222233311111112222222211111111-11111111111111111112221132333112 5444C791SCB366876956777676777577777776675667777677677979677777A9999969BBB8DLE8GE89999998-7C7687A8976697BCI38JOEIMNIKEABAC8BANHBP9**F1GGT98A8LBCEBACA8AC77PBEBCEBFO9OEABR8-C9DA859C8*787B9OUYa7LH99IIJL8 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---- STR:NPRED 490 STR:RPRED 76.1 SQ:SECSTR ccccccEEEEccccEEEEEEEccccEEEcccTTccccEEccEEEETcTEEEETHHHHHcTTccTTTEEccGGGGTTccTTcHHcccEEEcHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcTTccHHHHHHHHHHHHHTTcEEEEEEEHHHHHHHHTTGGccccEEEEEEEEccccEEEEEEEEETTEEEEEEEEEETTccTHHHHHHHHHHHHHHHHHHHccccTTcTTHHHHHHHHHHHHHHHTTTccEEEEEEEEEETcccTTEEEEEEEEHHHHHHHTHHHHHTTHHHHHHHHHHTTccGGGccEEEEEcGGGGcHHHHHHHHHTTTccEEccccGGGHHHHHHHHHHHHTTTTcccccccccccccEEEEETTTEEEEEEcTTccccEEEEEEEccccTTccEEEEEEEEcccccTTccEEEEEEEEEccccccTTcccEEEEEEEcTTccEEEEEEcTTTccEEEEEccccccccHHHHHHHE########################################################################################################################################################## PSIPRED cccccEEEEEcccccEEEEEEEccEEEEEEEccccccccEEEEEcccccEEEcHHHHHHHHHcccHHHHHHHHHccccccEEEEccEEEcHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHcccccccEEEEEEEccccEEEEEEEEEcccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccEEEEEccccccHHHHHHHHHHccccccccccccHHHHccHHHHHHHHccccccEEEEEEEEEEEEEEEEcccEEEEEccccccccccEEEEEEEcccccEEEEEEEEccccccccccEEEEEEEccccccccccEEEEEEEEEcccccEEEEEEEcccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccc //