[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM56290.1
DDBJ      :             Protein of unknown function DUF1119
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:340 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   28->327 PF06550 * DUF1119 9e-43 51.8 %
:HMM:PFM   13->328 PF06550 * DUF1119 7.1e-82 46.7 274/283  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM56290.1 GT:GENE ACM56290.1 GT:PRODUCT Protein of unknown function DUF1119 GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION complement(706102..707124) GB:FROM 706102 GB:TO 707124 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF1119 GB:NOTE PFAM: Protein of unknown function DUF1119; SMART: Peptidase A22, presenilin signal peptide; KEGG: hwa:HQ1505A hypothetical protein GB:PROTEIN_ID ACM56290.1 GB:DB_XREF GI:222452025 InterPro:IPR006639 InterPro:IPR010545 LENGTH 340 SQ:AASEQ MFPREYRGVAFVVGLFLVVQLGALALVPEFAESGYQAVDNPDNPTNSLLYIAAIIAMTGLMLAAFRYDLDQGIRLLIVGVSAWLSWYVFSAVVSQLAAAVPAIAVGVALLVYPEWYVIDTAGVLMGAGAAGLFGISFGLLPALLLLAFLAVYDAISVYGTEHMLSLAEGVMDLNIPVVLVIPLSLSYSLLGEQSESEGDDTDGDSAIDDGDPDANSDDLDNPDESADEGADVSEPTDIEDRDAFFIGLGDAVIPTVLVASAATFSPAAALDMPLIGINLPALLAMVGSLAGLLVLMSWVIKGRPHAGLPLLNGGAIGGYLIGSVVAGVPLIEAVGLAGFL GT:EXON 1|1-340:0| TM:NTM 9 TM:REGION 11->33| TM:REGION 45->67| TM:REGION 73->95| TM:REGION 102->124| TM:REGION 132->154| TM:REGION 167->189| TM:REGION 242->264| TM:REGION 273->295| TM:REGION 311->333| SEG 8->27|gvafvvglflvvqlgalalv| SEG 96->111|laaavpaiavgvallv| SEG 121->134|agvlmgagaaglfg| SEG 139->150|llpallllafla| SEG 191->213|geqsesegddtdgdsaiddgdpd| SEG 259->269|asaatfspaaa| RP:PFM:NREP 1 RP:PFM:REP 28->327|PF06550|9e-43|51.8|257/283|DUF1119| HM:PFM:NREP 1 HM:PFM:REP 13->328|PF06550|7.1e-82|46.7|274/283|DUF1119| OP:NHOMO 20 OP:NHOMOORG 19 OP:PATTERN -----------------------111111111-----------1111111111--------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 340-341| PSIPRED cccccccHHHHHHHHHHHHHHHHHHcccHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccEEccccccccccccccccccccccccccccccccccccHHHccccccccccccccEEEEEccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEcHHHHHHHHHHHHHHccHHHHHHHHHccc //