[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM56309.1
DDBJ      :             respiratory-chain NADH dehydrogenase subunit 1
Swiss-Prot:             

Homologs  Archaea  51/68 : Bacteria  591/915 : Eukaryota  45/199 : Viruses  0/175   --->[See Alignment]
b.71.1
:357 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  175->270 1bf2A2  b.71.1.1 * 3e-07 11.8 %
:RPS:PFM   52->349 PF00146 * NADHdh 3e-52 44.9 %
:HMM:PFM   47->352 PF00146 * NADHdh 2.5e-78 36.8 291/311  
:BLT:SWISS 50->350 NUOH_DEHSC 6e-63 43.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM56309.1 GT:GENE ACM56309.1 GT:PRODUCT respiratory-chain NADH dehydrogenase subunit 1 GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION 721460..722533 GB:FROM 721460 GB:TO 722533 GB:DIRECTION + GB:PRODUCT respiratory-chain NADH dehydrogenase subunit 1 GB:NOTE PFAM: respiratory-chain NADH dehydrogenase subunit 1; KEGG: nph:NP2298A NADH dehydrogenase-like complex, subunit H GB:PROTEIN_ID ACM56309.1 GB:DB_XREF GI:222452044 InterPro:IPR001694 LENGTH 357 SQ:AASEQ MGTAPAQLFPEFLVDTFGLPGVLGEVVASLIGAALVANIILAFSGIAGPWAKRKITAAFTDRIAVNRIGPFGLLIIPAAAVQLLAKELIIPEGVDRPTWDIAPILLPASAMLGFSVIPMGQIGPLNIHLADPEVGLALVFAFASIASVSLVMAGYASNNKYSLLGGLRAVAQNLAYEIPLIVTAMSVVVFAGTLQISGVVGAQTETLVTIAGFDIPAWFAFVNPFAFVLFLTANMAEIGRNPFDIPEAPTEIVGGYQTEYSSAYFVLFYLGEFVHIFLGGAILSVVFLGGASGPGPESISFIWFVVKVWGFFLFTQWARAAIPRVRIDQLIEIGWKGMLVLSFANLVLTAVIVGVIA GT:EXON 1|1-357:0| BL:SWS:NREP 1 BL:SWS:REP 50->350|NUOH_DEHSC|6e-63|43.5|283/353| TM:NTM 9 TM:REGION 18->40| TM:REGION 65->87| TM:REGION 103->125| TM:REGION 135->156| TM:REGION 177->199| TM:REGION 211->233| TM:REGION 264->286| TM:REGION 294->316| TM:REGION 335->357| RP:PFM:NREP 1 RP:PFM:REP 52->349|PF00146|3e-52|44.9|283/306|NADHdh| HM:PFM:NREP 1 HM:PFM:REP 47->352|PF00146|2.5e-78|36.8|291/311|NADHdh| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF00146|IPR001694| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00146|IPR001694| RP:SCP:NREP 1 RP:SCP:REP 175->270|1bf2A2|3e-07|11.8|85/113|b.71.1.1| OP:NHOMO 792 OP:NHOMOORG 687 OP:PATTERN 11-11111111111111112222111111211-------------2-111112-32211131111-11 22212---------11111-11--11111111112111111111-1--1-----1-----32111112221-----------23211111111---1--1-11--22211--------------1111111111212222211121111111111111111111111111111111111111111111--1-1-111111111111111------111111----------11----------------------------------------------------------------------------------------------1-----------------------2--1-1111----21-------22-111111111111111112322211111111111-11111111111111112221112211111111222211111111111222-11131111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111121111---1---231222-222122217222212-2111111111111111111111121211111---------------------1----11--311111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111111111111111--1----------------11111111111-1111111111111-1111111111111--------------11111111111111112-111111------------------------------------11-111-11-121 ---------------------------1---11-11-------1---1------231-----1-1----------------------------1---11----1-1------11111-----1-1--1-12--11-----1--11--------1-1------12--12--1-11-1----------1-6--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 9-14,17-18| PSIPRED ccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //