[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM56315.1
DDBJ      :             proton-translocating NADH-quinone oxidoreductase, chain M
Swiss-Prot:             

Homologs  Archaea  57/68 : Bacteria  691/915 : Eukaryota  54/199 : Viruses  0/175   --->[See Alignment]
:509 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   232->446 2c1wA PDBj 6e-21 8.8 %
:RPS:PFM   132->405 PF00361 * Oxidored_q1 3e-28 38.2 %
:HMM:PFM   131->414 PF00361 * Oxidored_q1 9.7e-69 30.0 267/270  
:HMM:PFM   73->120 PF01059 * Oxidored_q5_N 5.8e-08 31.2 48/110  
:BLT:SWISS 31->463 NU4C3_SYNP2 4e-77 40.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM56315.1 GT:GENE ACM56315.1 GT:PRODUCT proton-translocating NADH-quinone oxidoreductase, chain M GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION 726029..727558 GB:FROM 726029 GB:TO 727558 GB:DIRECTION + GB:PRODUCT proton-translocating NADH-quinone oxidoreductase, chain M GB:NOTE TIGRFAM: proton-translocating NADH-quinone oxidoreductase, chain M; PFAM: NADH/Ubiquinone/plastoquinone (complex I); KEGG: hwa:HQ1647A NADH dehydrogenase, subunit M (ubiquinone) GB:PROTEIN_ID ACM56315.1 GB:DB_XREF GI:222452050 InterPro:IPR001750 InterPro:IPR003918 InterPro:IPR010227 LENGTH 509 SQ:AASEQ MIEALIGVTFVAALLVLLAPNEWAGRLAFAFSLLPFAGSLYLWSGFESAGNALTGGDIAYATQIEWLEVGGRTVSWFVGVDGISLPLVVLTTFLVPLAIVSAWTPIDARQSQFYGLMLFMEANLLGVFTALDFFLWFVFWEAVLVPMYFLIGIWGGPRRKYAAIKFFVYTNAASLLMFIGFMSLTFALGDSVSSFALPEITQAIADGGLGTWFGISPDRIAMIAFLAMFLGFAVKVPIVPFHTWLPDAHVEAPTPVSVLLAGVLLKMGTYALLRFNFTMLPEQASALAVPIAAIAVISVIYGAMLALGQKDLKRIVAYSSVSSMGYVILGLIVFTEYGVGGATFQMVAHGLISGLMFMAVGVIYNATHTRMVGDMSGMADRMPVAVGILVAGAFGYMGLPLMAGFAGEFFIFVGSFAAPALPYAPIFTALAMFGIVIVAGYLLSAMQSTLFGPFELETDYDVGPAPFHDVAPLAVLLVAIIVLGVAPDIFFEMIRDAAVPVVEGVTVDG GT:EXON 1|1-509:0| BL:SWS:NREP 1 BL:SWS:REP 31->463|NU4C3_SYNP2|4e-77|40.0|408/550| TM:NTM 11 TM:REGION 10->32| TM:REGION 79->101| TM:REGION 123->145| TM:REGION 169->191| TM:REGION 219->241| TM:REGION 254->276| TM:REGION 290->312| TM:REGION 333->355| TM:REGION 385->407| TM:REGION 426->448| TM:REGION 470->492| SEG 11->19|vaallvlla| SEG 85->97|lplvvlttflvpl| SEG 284->300|asalavpiaaiavisvi| SEG 470->487|vaplavllvaiivlgvap| RP:PDB:NREP 1 RP:PDB:REP 232->446|2c1wA|6e-21|8.8|205/273| RP:PFM:NREP 1 RP:PFM:REP 132->405|PF00361|3e-28|38.2|254/268|Oxidored_q1| HM:PFM:NREP 2 HM:PFM:REP 131->414|PF00361|9.7e-69|30.0|267/270|Oxidored_q1| HM:PFM:REP 73->120|PF01059|5.8e-08|31.2|48/110|Oxidored_q5_N| GO:PFM:NREP 3 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF00361|IPR001750| GO:PFM GO:0042773|"GO:ATP synthesis coupled electron transport"|PF00361|IPR001750| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00361|IPR001750| OP:NHOMO 3137 OP:NHOMOORG 802 OP:PATTERN 22315121333333316112122256665676-1---2-----3121435735-74494D55323-33 6473642533322144344-44--444444444565354332231424721-222232--86533756794--------41177834533333---2--3-332-66643--------------353353553365AAA9A666758A9899A8788565555A887AA9744444444434422422--3-5233333233333323342222233252544222222222223334334333333344444----------------------------------------------------------------------14--3----------2--------3---5--337753--234622411--5A4333444445544445545B77744444444444-443443744353466578B644A956666556677745533333333866-457A4444544444444455444444444555533333-34444444444333334436545535447455522222334335456455474433332222222447526535-525-655225-897599A4L76773B-6255422222222322122222664744443-4-22-11------53-----333-563--D76623122233554435553533333-5555533554535455555333433343333333333333333333444453-433333333333333655554333371231----2----------555554533321444434434333354443333333335----11111-----44545445553333334-333333------------------------------------142112-1215C2 --------------1--1---------211-11222-------21--2------353-----1-1-------------------1--------2---22------2------21223-----2-31-2-25--22-----2--22--------2-2------21-1241-1--2-2----------1-7-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 40.3 SQ:SECSTR #######################################################################################################################################################################################################################################ccccTTTEEEcccccccccccccccEEEEHHHHTTTcTHHHHHHHHHHH##########HHcccccccccHHHHHHHHHHHHHHTTcHHHHHHHHHHHHTTccccHHHHHHHHHHHHHccccccccccccHHHHHTTccccccccccccHHHHHHHTTcEEEEEEccccccccccTTccEEEEEEEETTcccccEEEEccccHHHHHHHHHHHHH############################################################### DISOP:02AL 509-510| PSIPRED cHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHccHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHcccHHHHHHHHHHHHccc //