[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM56400.1
DDBJ      :             ATP binding protein
Swiss-Prot:             

Homologs  Archaea  63/68 : Bacteria  18/915 : Eukaryota  139/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:238 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->238 3h7eA PDBj 5e-29 39.6 %
:RPS:PDB   4->238 2d13D PDBj 2e-39 37.4 %
:RPS:SCOP  6->238 1ru8A  c.26.2.1 * 9e-50 36.9 %
:HMM:SCOP  1->240 2d13A1 c.26.2.1 * 1e-58 43.5 %
:RPS:PFM   6->224 PF01902 * ATP_bind_4 9e-39 44.4 %
:HMM:PFM   6->236 PF01902 * ATP_bind_4 2.8e-57 46.0 213/219  
:BLT:SWISS 8->237 Y570_METJA 3e-35 39.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM56400.1 GT:GENE ACM56400.1 GT:PRODUCT ATP binding protein GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION 802173..802889 GB:FROM 802173 GB:TO 802889 GB:DIRECTION + GB:PRODUCT ATP binding protein GB:NOTE TIGRFAM: ATP binding protein; PFAM: protein of unknown function DUF71 ATP-binding region; KEGG: hma:rrnAC0632 hypothetical protein GB:PROTEIN_ID ACM56400.1 GB:DB_XREF GI:222452135 InterPro:IPR002761 LENGTH 238 SQ:AASEQ MTDDWVSLFSGGKDSSWALYRALEEGLDVSRLLTVHPAGDSYMYHTPATELAALAAESVGIDLVEVSPADFGADDVDDAGEQGDAELEPMEAALREIAAGDDVDLAGVTAGAVESEFQTSRIQGMCDRLGIDLFAPLWQESPVALAEAMFEAGFEIRIVQVAAYGLDESWLGRRYDADALAELVDLREECGVHPLGEGGEFETYVVDGPHMDRRIDMEYDTVWEGDRGHVEIRDARLE GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 8->237|Y570_METJA|3e-35|39.2|212/223| SEG 46->57|tpatelaalaae| SEG 69->80|adfgaddvddag| BL:PDB:NREP 1 BL:PDB:REP 4->238|3h7eA|5e-29|39.6|212/220| RP:PDB:NREP 1 RP:PDB:REP 4->238|2d13D|2e-39|37.4|198/203| RP:PFM:NREP 1 RP:PFM:REP 6->224|PF01902|9e-39|44.4|205/219|ATP_bind_4| HM:PFM:NREP 1 HM:PFM:REP 6->236|PF01902|2.8e-57|46.0|213/219|ATP_bind_4| RP:SCP:NREP 1 RP:SCP:REP 6->238|1ru8A|9e-50|36.9|214/227|c.26.2.1| HM:SCP:REP 1->240|2d13A1|1e-58|43.5|223/0|c.26.2.1|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 260 OP:NHOMOORG 220 OP:PATTERN 1111111111111111111--1-21111111111111111221111111111212222111111--11 ----------------------------------------------------------------------------------------------------------1----------------------------------532----------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------1-------1-1-1---122----------------------------1----------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------- 1-11111-31---1111-1------11--------1----------11-1-----11--111111111-11111111--111111111-1111111-1-1-111111121111-11---1-1112-11-131-11111111-12-1-1111111111-112-1111111261111111171111111-21111-11111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 238 STR:RPRED 100.0 SQ:SECSTR cccEEEEEccccHHHHHHHHHHHHTTcEEEEEEEEEccHHHHTHHHHHHHHHHHHHHHHTccEEEEEcHHHHHHHHHHHHHTTEcccHHHHHHHHTHHHTccccccEEEccccccHHHHHHHHHHHHHTTcEEEcTTccccHHHHHHHHHHHTcEEEEEEEccTTccGGGTTccccHHHHHHHHHHHHHHcccTTcTTccEEEEEEEcTTccEEEEEEEEEEEccccEEEEEEEEEEE PSIPRED ccccEEEEEcccHHHHHHHHHHHHccccEEEEEEEEccccccccccccHHHHHHHHHHccccEEEEEcccccccHHHHcccccccHHHHHHHHHHHHHHHccccccEEEEccEEcHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHccccEEEEEEEcccccHHHccEEccHHHHHHHHHHHHcccccccccccEEEEEEEEccccccEEEEEEEEEEEcccEEEEEEEEEcc //