[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM56534.1
DDBJ      :             Protein of unknown function DUF293
Swiss-Prot:             

Homologs  Archaea  49/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   10->71 2acjC PDBj 2e-04 16.7 %
:RPS:SCOP  5->82 1tqiA1  a.4.5.56 * 5e-06 15.6 %
:HMM:SCOP  8->136 1xd7A_ a.4.5.55 * 3.2e-17 27.2 %
:RPS:PFM   6->78 PF03444 * DUF293 2e-11 42.5 %
:HMM:PFM   5->82 PF03444 * DUF293 2.1e-40 71.8 78/79  
:BLT:SWISS 4->165 Y1232_METJA 4e-33 42.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM56534.1 GT:GENE ACM56534.1 GT:PRODUCT Protein of unknown function DUF293 GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION 935342..935875 GB:FROM 935342 GB:TO 935875 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF293 GB:NOTE PFAM: protein of unknown function UPF0074; Protein of unknown function DUF293; Helix-turn-helix type 11 domain protein; KEGG: hwa:HQ2649A transcriptional regulator GB:PROTEIN_ID ACM56534.1 GB:DB_XREF GI:222452269 InterPro:IPR000944 InterPro:IPR005104 InterPro:IPR013196 LENGTH 177 SQ:AASEQ MSSIELTSSQKSILTALINLYGEQEDAVKGEAIAEEVDRNPGTIRNQMQSLKALQLVEGVPGPKGGYKPTSNAYEALDIQRMDEPADVPIFHEGEEVTGVNVDGIDLSSVHHPELCRAEIHVQGSVRDFHEGDSVTVGPTPLSKLVIDGTVDGKDDTANVLILRIDDMRAPDEPAEH GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 4->165|Y1232_METJA|4e-33|42.9|161/296| RP:PDB:NREP 1 RP:PDB:REP 10->71|2acjC|2e-04|16.7|60/66| RP:PFM:NREP 1 RP:PFM:REP 6->78|PF03444|2e-11|42.5|73/76|DUF293| HM:PFM:NREP 1 HM:PFM:REP 5->82|PF03444|2.1e-40|71.8|78/79|DUF293| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF03444|IPR005104| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF03444|IPR005104| RP:SCP:NREP 1 RP:SCP:REP 5->82|1tqiA1|5e-06|15.6|77/90|a.4.5.56| HM:SCP:REP 8->136|1xd7A_|3.2e-17|27.2|125/127|a.4.5.55|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 53 OP:NHOMOORG 49 OP:PATTERN 11---111111111111111-11121121211111111111111111111111--------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 37.9 SQ:SECSTR ####cHHHHHHHHHHHHHHTcEcTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEcccccEEEEcc########################################################################################################## DISOP:02AL 176-178| PSIPRED cccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEccccccccccccHHHHHHHcccccccccEEEEEEccEEEEcEEEEEEEccccccccccEEEEEEEEcHHHcccccEEEEEEEccEEEEEEEEEEEccccccEEEEEEEEEEcccccccc //