[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM56536.1
DDBJ      :             purine or other phosphorylase family 1
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  368/915 : Eukaryota  39/199 : Viruses  0/175   --->[See Alignment]
c.56.2
:275 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->245 1u1gA PDBj 5e-46 43.3 %
:RPS:PDB   31->235 3ddoF PDBj 3e-61 43.4 %
:RPS:SCOP  14->251 1nw4A  c.56.2.1 * 5e-54 26.9 %
:HMM:SCOP  16->258 1je0A_ c.56.2.1 * 4.6e-72 43.9 %
:RPS:PFM   62->171 PF01048 * PNP_UDP_1 8e-09 41.8 %
:HMM:PFM   30->239 PF01048 * PNP_UDP_1 3.2e-50 33.0 197/234  
:BLT:SWISS 31->255 UDP_KLEAE 6e-46 42.7 %
:PROS 74->89|PS01232|PNP_UDP_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM56536.1 GT:GENE ACM56536.1 GT:PRODUCT purine or other phosphorylase family 1 GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION complement(937343..938170) GB:FROM 937343 GB:TO 938170 GB:DIRECTION - GB:PRODUCT purine or other phosphorylase family 1 GB:NOTE PFAM: purine or other phosphorylase family 1; KEGG: hsl:OE2311R uridine phosphorylase GB:PROTEIN_ID ACM56536.1 GB:DB_XREF GI:222452271 InterPro:IPR000845 LENGTH 275 SQ:AASEQ MTDKSDRSEDPNDEVQYHVEVGEDDVADAVLLPGNPERVDKITALWDGHEEVAHHREYRTATGTYEDAPISVTSTGIGSPSAAIAVEELARVGVDTFIRVGSCGAIQPGMDVGDLVITTGAVRQEGTSDEYVREDYPAAADGEVVSALVAAAERLGYDYHTGVTMSADSFYAGQGRPGFEGFEAAGSDELVAELQDANVKNIEMEASAILTIANVYGLRAGAICSVYANRVTGEFRTEGESRTAETASLAVTLLARMDEVKREAGADRWHAGLSL GT:EXON 1|1-275:0| BL:SWS:NREP 1 BL:SWS:REP 31->255|UDP_KLEAE|6e-46|42.7|225/253| PROS 74->89|PS01232|PNP_UDP_1|PDOC00946| SEG 19->30|vevgeddvadav| BL:PDB:NREP 1 BL:PDB:REP 31->245|1u1gA|5e-46|43.3|215/245| RP:PDB:NREP 1 RP:PDB:REP 31->235|3ddoF|3e-61|43.4|205/243| RP:PFM:NREP 1 RP:PFM:REP 62->171|PF01048|8e-09|41.8|110/229|PNP_UDP_1| HM:PFM:NREP 1 HM:PFM:REP 30->239|PF01048|3.2e-50|33.0|197/234|PNP_UDP_1| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01048|IPR000845| GO:PFM GO:0009116|"GO:nucleoside metabolic process"|PF01048|IPR000845| RP:SCP:NREP 1 RP:SCP:REP 14->251|1nw4A|5e-54|26.9|227/243|c.56.2.1| HM:SCP:REP 16->258|1je0A_|4.6e-72|43.9|230/234|c.56.2.1|1/1|Purine and uridine phosphorylases| OP:NHOMO 746 OP:NHOMOORG 444 OP:PATTERN 22213211111111114222122-22223122-------------------------21111--1--- ------------1----------------------------------1---1---1----111-1--1--------------1-----2222-222---211-2-111-1-----------------------------11-----1-1---1----------------1-------------12111---1111111111111111111-1111111211-1111111112-1222222222222221--111-1-22-------1112------2222221---1111112211111222222222222221331113331-11-2-------3-41---1222--1121-1------------111-111-----------------1----------------------------1--1-----------------1-----111---------11------------------------------------------------------------------------------------------------1--------------------------------1---1-----1--1-----------1-1111111-------441---11-222323322432232544383--1----11-11132223222222222222-2222222222222222222222222222323232223232332222222221-22222222222211--111111111--11-222222111112222----------1------------------111111111-2544444444434411---------------3--------------12-------1---111---1--1------21---3----1- 11--221-21--11-------------------------------------------------------------------------------111----1-1------1222221---1------1--------31----1-1--1---11-1-1-1---1--3--2------1-------------------2-1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 94.2 SQ:SECSTR ############ccccTTTcccTTccccEEEEEccHHHHHHHHTTcEEEEEEEEETTEEEEEEEETTEEEEEEcccccHHHHHHHHHHHHHHTccEEEEEEEEEEccTTccTTcEEEEEEEEEEccGGGGTccTTccEEccHHHHHHHHHHHHHHTccEEEEEEEEEccccGGGTcccccccccGGGTTHHHHHHHTTccEEEccHHHHHHHHHTTTcEEEEEEEEEEETTTcccHHHHHHHHHHHHHHHHHHHHHHHHccccHTTccTTT#### DISOP:02AL 274-276| PSIPRED ccccccccccccccccccccccHHHcccEEEEcccHHHHHHHHHHccccEEEEEEcccEEEEEEEccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccEEEEEHHccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHccccEEEccHHHHHHHHHHccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //