[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM56582.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM56582.1 GT:GENE ACM56582.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION 977446..977667 GB:FROM 977446 GB:TO 977667 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: nph:NP3630A hypothetical protein GB:PROTEIN_ID ACM56582.1 GB:DB_XREF GI:222452317 LENGTH 73 SQ:AASEQ MIEDCQHLYERRIGGFEALSAFLDELANADVTVVTGWNRYAWVYLAAVQALDREFLVTVEIQPFPKNGSRNSC GT:EXON 1|1-73:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------------------------------11------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 73-74| PSIPRED ccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHcccEEEEEEEEcccccccccccc //