[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM57205.1
DDBJ      :             Xylose isomerase domain protein TIM barrel
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  131/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.15
:323 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   151->316 2zdsB PDBj 1e-13 35.9 %
:RPS:PDB   1->311 3cqjA PDBj 9e-18 16.0 %
:RPS:SCOP  1->312 1xp3A1  c.1.15.1 * 8e-18 12.8 %
:HMM:SCOP  1->311 1qt1A_ c.1.15.3 * 4.1e-50 32.3 %
:RPS:PFM   153->230 PF01261 * AP_endonuc_2 2e-06 45.9 %
:RPS:PFM   269->307 PF07582 * AP_endonuc_2_N 5e-07 53.8 %
:HMM:PFM   20->237 PF01261 * AP_endonuc_2 4.2e-37 34.4 183/211  
:HMM:PFM   268->322 PF07582 * AP_endonuc_2_N 1.1e-20 32.7 55/55  
:BLT:SWISS 1->311 YFIH_BACSU 1e-55 36.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM57205.1 GT:GENE ACM57205.1 GT:PRODUCT Xylose isomerase domain protein TIM barrel GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION complement(1640278..1641249) GB:FROM 1640278 GB:TO 1641249 GB:DIRECTION - GB:PRODUCT Xylose isomerase domain protein TIM barrel GB:NOTE PFAM: AP endonuclease 2 domain protein; Xylose isomerase domain protein TIM barrel; KEGG: hma:rrnAC0265 AP-endonuclease/AP-lyase GB:PROTEIN_ID ACM57205.1 GB:DB_XREF GI:222452940 InterPro:IPR011418 InterPro:IPR012307 LENGTH 323 SQ:AASEQ MDIGVLTVPLGGESIDDAVAYLDDIGVDAVELGVGGWPSEDHVDREAILDDDAAQAELRELLDEHGLRISALATHNNPLHPDEERAAAADRELREAIELADQLDVGTVTCFSGLPAGAPGDSTPNWITAPWPSEHADAHEYQWDEVAIPYWTDLAKHADHHGVDVAIEMHPNMLVYEPTGMLALREATNERIGANFDPSHLYWQGIDVIEAIRFLGDHDAIHHFHAKDTKVYDANARVKGVLDTTSYTDESDRSWLFRSIGYGHDESHWKDVVSTLRMVGYEGALSIEHEDSLTSSREGLEKAVDVLDRAVFETQPGDAYWAE GT:EXON 1|1-323:0| BL:SWS:NREP 1 BL:SWS:REP 1->311|YFIH_BACSU|1e-55|36.4|308/313| SEG 82->100|deeraaaadrelreaiela| BL:PDB:NREP 1 BL:PDB:REP 151->316|2zdsB|1e-13|35.9|153/318| RP:PDB:NREP 1 RP:PDB:REP 1->311|3cqjA|9e-18|16.0|263/276| RP:PFM:NREP 2 RP:PFM:REP 153->230|PF01261|2e-06|45.9|74/200|AP_endonuc_2| RP:PFM:REP 269->307|PF07582|5e-07|53.8|39/48|AP_endonuc_2_N| HM:PFM:NREP 2 HM:PFM:REP 20->237|PF01261|4.2e-37|34.4|183/211|AP_endonuc_2| HM:PFM:REP 268->322|PF07582|1.1e-20|32.7|55/55|AP_endonuc_2_N| RP:SCP:NREP 1 RP:SCP:REP 1->312|1xp3A1|8e-18|12.8|274/297|c.1.15.1| HM:SCP:REP 1->311|1qt1A_|4.1e-50|32.3|263/0|c.1.15.3|1/1|Xylose isomerase-like| OP:NHOMO 162 OP:NHOMOORG 134 OP:PATTERN ------------------------1--1--1------------------------------------- 1-1-1---111---------------------------232---111--11-323--------1213111------------1----------1----------11121------------------------------22-------------------------------------------1------1-----------------21---1----11-1--11111111111111111111111---------------------------------------------------------------------------11--1-------------------------1------------2112-----11-----------1---------11111111111----------2--322121221111------1111111-------------------------------------------------1---------------------11------1-1--------------1----2------------------------------------------------------------------------------------1-1--1-----------------1--1-------------1--1------------------------------------1--------------------2-------------------------------------11---1-1-------------------11-----1-----------------------------------------------------------------------------------------------------1----1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 316 STR:RPRED 97.8 SQ:SECSTR ccEEEEGGGcccccHHHHHHHHHHTTccEEEEEccccHHHHGGGGcGGcccHHHHHHHHHHHHHHccEEEEEEEGccTTcccHHHHHHHHHHHHHHHHHHHHHTccEEEEccTcccTcEEccGGcEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHTcEEEEEccccGGGccHHHHHHHHHHHcTTEEEEccHHHHHcccccHHHHHHHTGGGTccccEEEcEEETTEcGGGcccccccGcHHHHHcccccEEEEcTTcccccHHHHHHHHHHTTccccEEEcccGGcccHHHHHHHHHHHHHHHHTcccc####### PSIPRED cEEEEEcHHHccccHHHHHHHHHHccccEEEEccccccccccccHHHccccHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHccccccEEEEEEHHHHHHccccHHHHHHHHccccEEEEEEEEEcccccccccHHHccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHHHHHHcccccccccccc //