[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM57245.1
DDBJ      :             SNARE associated Golgi protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:225 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   63->178 PF09335 * SNARE_assoc 2e-04 30.4 %
:HMM:PFM   63->178 PF09335 * SNARE_assoc 2.7e-15 28.9 114/123  
:BLT:SWISS 50->173 YDJZ_ECOLI 4e-08 41.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM57245.1 GT:GENE ACM57245.1 GT:PRODUCT SNARE associated Golgi protein GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION complement(1680573..1681250) GB:FROM 1680573 GB:TO 1681250 GB:DIRECTION - GB:PRODUCT SNARE associated Golgi protein GB:NOTE PFAM: SNARE associated Golgi protein; KEGG: hwa:HQ2782A hypothetical protein GB:PROTEIN_ID ACM57245.1 GB:DB_XREF GI:222452980 InterPro:IPR015414 LENGTH 225 SQ:AASEQ MNRRTGVAGYVLAGVALAALSAVAWVVSPDAVLGPLTWLADDPVRFGAALIALTAIRPLLAWPTTLLAVVAGFGYGWAGVPIGVAAMVATALPPYWLARAGRVRARDGSQIADRLCGAGERLADATGGVRAVTATRLLPVPSDAVSLAAGGSGIRLRSLLFGTALGELPWAIVGVAIGVSVDRLANGGTASIDPTVLVAMAGLGTLLLAGPLYRTFIRDRASPTA GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 50->173|YDJZ_ECOLI|4e-08|41.0|117/235| TM:NTM 5 TM:REGION 12->34| TM:REGION 47->69| TM:REGION 76->98| TM:REGION 160->182| TM:REGION 191->213| SEG 6->27|gvagyvlagvalaalsavawvv| SEG 197->212|lvamaglgtlllagpl| RP:PFM:NREP 1 RP:PFM:REP 63->178|PF09335|2e-04|30.4|115/119|SNARE_assoc| HM:PFM:NREP 1 HM:PFM:REP 63->178|PF09335|2.7e-15|28.9|114/123|SNARE_assoc| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN ------------------------11111111------------------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-28,31-32| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //