[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM57293.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:257 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->21 PF08085 * Entericidin 0.00049 42.9 21/42  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM57293.1 GT:GENE ACM57293.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION 1727511..1728284 GB:FROM 1727511 GB:TO 1728284 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: hwa:HQ2489A hypothetical protein GB:PROTEIN_ID ACM57293.1 GB:DB_XREF GI:222453028 LENGTH 257 SQ:AASEQ MNRRFALALAVVALLVVSAGCLTYINDGGEVANETLDAEPPQAYDFATDRDTAINLSTGTRYTAVYNVSGVDEIRFYRQTPYTGDQPFEFEAFRYQYPDGEVVNGSEFRARGGEIDRTPDETWVRFDDEMDGGRMAISASGSPRRFTTLTYIEGSYVVTLPPGFSTDMPIVGHVSPRGYEIETIDGRDQITWDSVTSGSVVVQSYRETDLLVFGVILVIAAIAAVIGTVYFRRQLEELRERRRQMGLGVYEDDEDDE GT:EXON 1|1-257:0| TM:NTM 2 TM:REGION 5->27| TM:REGION 201->223| SEG 6->17|alalavvallvv| SEG 210->227|llvfgvilviaaiaavig| SEG 232->244|rrqleelrerrrq| HM:PFM:NREP 1 HM:PFM:REP 1->21|PF08085|0.00049|42.9|21/42|Entericidin| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN ------------------------1111111------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,257-258| PSIPRED ccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccEEEEEEcccEEEEEEEEcccEEEEEEEEcccccccccEEEEEEEEcccccEEEcccccccccccccccccEEEEEEEcccccEEEEEEcccccEEEEEEEEcccEEEEEcccccccccEEEEEccccEEEEEEccEEEEEEEcccccEEEEEEEEccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //