[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM57526.1
DDBJ      :             protein of unknown function DUF1684
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  49/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:192 amino acids
:PSIPRED
:RPS:PFM   41->181 PF07920 * DUF1684 7e-28 52.9 %
:HMM:PFM   41->182 PF07920 * DUF1684 8.9e-54 50.4 141/143  
:BLT:SWISS 64->157 EFG_BIFAA 3e-04 30.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM57526.1 GT:GENE ACM57526.1 GT:PRODUCT protein of unknown function DUF1684 GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION complement(1948657..1949235) GB:FROM 1948657 GB:TO 1949235 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1684 GB:NOTE PFAM: protein of unknown function DUF1684; KEGG: hwa:HQ2371A hypothetical protein GB:PROTEIN_ID ACM57526.1 GB:DB_XREF GI:222453261 InterPro:IPR012467 LENGTH 192 SQ:AASEQ MTETTPDDDWAAQIEAQRRAKHEHFRDSARSPLPASMRGDAFPGLAYFDPDPAYRFVVPLHEHDEKETVTVETTADGEQTYRRWGEFRLEIDGETVTLQAYRPTDGADRFWVPFRDETSGETTYGAGRYLDLEPDRDRVDGEWVVDCNVAYNPTCAYNHAYECPLIPMENWLDVAIEAGEKKFPAEPAGADH GT:EXON 1|1-192:0| BL:SWS:NREP 1 BL:SWS:REP 64->157|EFG_BIFAA|3e-04|30.4|92/709| RP:PFM:NREP 1 RP:PFM:REP 41->181|PF07920|7e-28|52.9|140/143|DUF1684| HM:PFM:NREP 1 HM:PFM:REP 41->182|PF07920|8.9e-54|50.4|141/143|DUF1684| OP:NHOMO 78 OP:NHOMOORG 57 OP:PATTERN ------------------------11112121------------------------------------ -11-2-------------------------------1111-1--12---232222---------1----1-------------------------------1111-131------------------------------------1-------------------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------11-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11222222221111---------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHcccccccccccccccEEEEEEEEcccccEEEEEcccccEEEEEEEEEEEEEEccEEEEEEEEEEcccccEEEEEEEccccccccccccEEEEccccccccccEEEEEccccccccccccccEEccccccccEEEEEEEccccccccccccccc //