[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM57727.1
DDBJ      :             naphthoate synthase
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  544/915 : Eukaryota  90/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->303 1q51B PDBj e-103 67.0 %
:RPS:PDB   18->301 1dciA PDBj 1e-41 21.1 %
:RPS:SCOP  4->303 1q51A  c.14.1.3 * 2e-50 64.7 %
:HMM:SCOP  17->303 1q52A_ c.14.1.3 * 1.6e-72 34.3 %
:RPS:PFM   34->223 PF00378 * ECH 4e-20 37.7 %
:HMM:PFM   33->223 PF00378 * ECH 2.4e-34 33.9 168/170  
:BLT:SWISS 18->300 MENB_BACSU 5e-66 51.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM57727.1 GT:GENE ACM57727.1 GT:PRODUCT naphthoate synthase GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION 2138350..2139261 GB:FROM 2138350 GB:TO 2139261 GB:DIRECTION + GB:PRODUCT naphthoate synthase GB:NOTE TIGRFAM: naphthoate synthase; PFAM: Enoyl-CoA hydratase/isomerase; KEGG: hwa:HQ1874A naphthoate synthase GB:PROTEIN_ID ACM57727.1 GB:DB_XREF GI:222453462 InterPro:IPR001753 InterPro:IPR010198 LENGTH 303 SQ:AASEQ MVSDIFDPDAWEPVTDEFDDITYHRGVDVPVVRIAFDRPEVRNAFRPGTVDELYAALDHARKQADVGCVLLTGNGPSEKDGGWAFCSGGDQSVRGGSGYEYRDDDEAGDEDDPLVKEARAGRLHVLEVQRLIRFMPKPVVAVVPGWAVGGGHSLHVICDLTLASEEHAKFLQTDPDVASFDGGFGSAYLAKQIGQKKAREVFFRGKTYSAEEAADMGMVNEAIPHEELEEVAIEWADEMTKKSPTAMRMLKYAFNMTDDGMVGQQVFAGEATRLAYMTDEAQEGRDAFLEKRDPEFRDYPWHY GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 18->300|MENB_BACSU|5e-66|51.8|257/271| SEG 103->112|dddeagdedd| SEG 138->151|pvvavvpgwavggg| BL:PDB:NREP 1 BL:PDB:REP 6->303|1q51B|e-103|67.0|276/280| RP:PDB:NREP 1 RP:PDB:REP 18->301|1dciA|1e-41|21.1|270/275| RP:PFM:NREP 1 RP:PFM:REP 34->223|PF00378|4e-20|37.7|167/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 33->223|PF00378|2.4e-34|33.9|168/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 4->303|1q51A|2e-50|64.7|269/271|c.14.1.3| HM:SCP:REP 17->303|1q52A_|1.6e-72|34.3|280/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 1219 OP:NHOMOORG 662 OP:PATTERN ------3443344442-11-211742222234------------------------------1-1-11 11-1221311111226322-2522382222236787358D-1141112111133221211-14112211-2--------1313-----1111-11----3111122121---------------11111121111132232----311111111111111111111-1111111111111111-11-----32222222223232322214222133238533311111114-111111111111111111111-1----1-----11---1-111111-------------------------------------111------1111111111111-2221221-1-1-2-11-351422-13---1--1-1--3332-----1-8341-165725--------------1----3428--11--1132-12221512111122222--------4----111------------------------------6-73--511233337111111224-2222124383AA5--431311333233331-3----11----------6243E3-1---------135428-1---1-12131---------------------------111---3-11111111-1211112121121-----1-------111111-1112121211-111111111112111111131311111111111111111111111111111--111111111111---------1111--11111111111111111133223--2322122222322-42331213----------1112111111111122---------------------------------------------------------------------11 ----111-211---11--------------------------------21--2-12----------------------------------2--122-----11211-2-1333232-1111-1-211-1161-122----21111--1--1--1-1111--11421-31111122211--111122323-21121111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 302 STR:RPRED 99.7 SQ:SECSTR #HHHHHcccccEEEccccccEEEEEcEETTEEEEEEccGGGTTcccHHHHHHHHHHHHHHHTcTTccEEEEEEcTTccccccccccccccHHHHHHHHTccTcccEccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEETHHHHHHTTccEEEEETTTcEEEccGGGGTccccccHHHHGGGTccHHHHHHHHHHccEEEHHHHHHHTcccEEEccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHTccHHHHHHHHHHHTTccGGGcccccTT DISOP:02AL 302-304| PSIPRED cccccccccccccccccccEEEEEEEccccEEEEEEccHHHHccccHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccEEccccHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEcccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccc //