[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM57757.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:132 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 34->95 K1462_HUMAN 8e-04 34.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM57757.1 GT:GENE ACM57757.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION complement(2167367..2167765) GB:FROM 2167367 GB:TO 2167765 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: hwa:HQ2768A hypothetical protein GB:PROTEIN_ID ACM57757.1 GB:DB_XREF GI:222453492 LENGTH 132 SQ:AASEQ MTRFDAATEGERLKLFADAATAHRARSSEVMTVDVDPDSDTTGGGEVPPWIQLAGTELILDCTDAELDLLKDLLGEFPEFRIDELVSPEEAEGTNAVVTARSDANRVAGFVERAFREVYGLDDDYRAWVTAI GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 34->95|K1462_HUMAN|8e-04|34.4|61/100| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------11-1-1------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 132-133| PSIPRED ccccccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccEEEcccEEEEEEcHHHHHHHHHHHHHccccEEHHHcccHHccccEEEEEEcccHHHHHHHHHHHHHHHHcccccHHHEEEcc //