[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM57762.1
DDBJ      :             protein of unknown function DUF92 transmembrane
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:430 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   194->419 PF01940 * DUF92 2.3e-58 38.0 221/225  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM57762.1 GT:GENE ACM57762.1 GT:PRODUCT protein of unknown function DUF92 transmembrane GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION complement(2169918..2171210) GB:FROM 2169918 GB:TO 2171210 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF92 transmembrane GB:NOTE PFAM: protein of unknown function DUF92 transmembrane; KEGG: hwa:HQ3330A hypothetical protein GB:PROTEIN_ID ACM57762.1 GB:DB_XREF GI:222453497 InterPro:IPR002794 LENGTH 430 SQ:AASEQ MAAVAVLAPALGDAAAVPFLAAAGLAFFGVRDGRWFETLALRGDREEERLYGFVAFALAAAGLALFASLPRAPLPYEAFAAATLAVGGGRLGRTVVAGRATDEFPLVAGYVAGGTLGALAGQVGVLLQTDRAGLVDGLPELVFLAAVAALTAALVRSLVFDRDAHITVILVAFAVWGFVALDPAVTASLVAFGLAVTGALGYVSFALGTASVPGMLTGVLSALLAVVLGGVGWFATLMSFYAIGGLASKYRFDEKADRGVAQENEGARGTGNVLANSAVALVAVVGYAATAHVGVPGALFGFAFAGATATAMADTLSSEIGGLYDGPRLVTTLSRVEPGTDGAVTWQGELAGLAGALLVAGLAAFGMPIGDAIAGGGIVVLAGVAGMTVDSLLGALIEGERIGNQAVNFLATLSGAIVGVAAAVALGVGL GT:EXON 1|1-430:0| TM:NTM 10 TM:REGION 6->28| TM:REGION 59->81| TM:REGION 106->128| TM:REGION 136->158| TM:REGION 175->197| TM:REGION 220->242| TM:REGION 279->301| TM:REGION 350->372| TM:REGION 377->399| TM:REGION 406->428| SEG 2->29|aavavlapalgdaaavpflaaaglaffg| SEG 52->67|gfvafalaaaglalfa| SEG 106->127|lvagyvaggtlgalagqvgvll| SEG 138->159|lpelvflaavaaltaalvrslv| SEG 218->232|gvlsallavvlggvg| SEG 272->291|nvlansavalvavvgyaata| SEG 297->315|galfgfafagatatamadt| SEG 348->366|gelaglagallvaglaafg| SEG 369->386|igdaiagggivvlagvag| SEG 415->429|gaivgvaaavalgvg| HM:PFM:NREP 1 HM:PFM:REP 194->419|PF01940|2.3e-58|38.0|221/225|DUF92| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN ------------------------11111111------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 73-84,87-88| PSIPRED ccHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccc //