[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 1
Gene : ACM57894.1
DDBJ      :             purine or other phosphorylase family 1
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  387/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
c.56.2
:241 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->184 2iq5B PDBj 4e-39 42.5 %
:RPS:PDB   6->219 3ddoF PDBj 1e-51 36.4 %
:RPS:SCOP  5->241 1nw4A  c.56.2.1 * 1e-51 31.0 %
:HMM:SCOP  3->241 1t8sA_ c.56.2.1 * 3e-71 37.7 %
:RPS:PFM   17->182 PF01048 * PNP_UDP_1 3e-14 36.1 %
:HMM:PFM   16->236 PF01048 * PNP_UDP_1 9.4e-50 32.7 220/234  
:BLT:SWISS 6->241 UDP_KLEAE 8e-37 41.1 %
:PROS 62->77|PS01232|PNP_UDP_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM57894.1 GT:GENE ACM57894.1 GT:PRODUCT purine or other phosphorylase family 1 GT:DATABASE GIB00862CH01 GT:ORG hlac0 GB:ACCESSION GIB00862CH01 GB:CHROMOSOME 1 GB:LOCATION 2312605..2313330 GB:FROM 2312605 GB:TO 2313330 GB:DIRECTION + GB:PRODUCT purine or other phosphorylase family 1 GB:NOTE PFAM: purine or other phosphorylase family 1; KEGG: hsl:OE3603R uridine phosphorylase GB:PROTEIN_ID ACM57894.1 GB:DB_XREF GI:222453629 InterPro:IPR000845 LENGTH 241 SQ:AASEQ MAKQPHLLVEEGDVHEIAIIPGDPGRVDRIADLCDDSELVAQNREYKIVNASYDGTDLTICSTGIGCPSAAIAVEELSRVGVETFLRCGTCGALQADMEVGDMVVATGAAKEEGTSKRYESVEYPAVPDYDALTELVGAAEDNDEEIHVGPIVSDDAFYNESDEYVDDWNDANLLAIEMEAATVFALARRKGLRAGAICTVDGNLVAGNQKGADSDDELPEKAKDNVERAIRITLNAVTAL GT:EXON 1|1-241:0| BL:SWS:NREP 1 BL:SWS:REP 6->241|UDP_KLEAE|8e-37|41.1|224/253| PROS 62->77|PS01232|PNP_UDP_1|PDOC00946| SEG 186->197|alarrkglraga| BL:PDB:NREP 1 BL:PDB:REP 6->184|2iq5B|4e-39|42.5|179/225| RP:PDB:NREP 1 RP:PDB:REP 6->219|3ddoF|1e-51|36.4|214/243| RP:PFM:NREP 1 RP:PFM:REP 17->182|PF01048|3e-14|36.1|166/229|PNP_UDP_1| HM:PFM:NREP 1 HM:PFM:REP 16->236|PF01048|9.4e-50|32.7|220/234|PNP_UDP_1| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01048|IPR000845| GO:PFM GO:0009116|"GO:nucleoside metabolic process"|PF01048|IPR000845| RP:SCP:NREP 1 RP:SCP:REP 5->241|1nw4A|1e-51|31.0|232/243|c.56.2.1| HM:SCP:REP 3->241|1t8sA_|3e-71|37.7|236/0|c.56.2.1|1/1|Purine and uridine phosphorylases| OP:NHOMO 724 OP:NHOMOORG 431 OP:PATTERN 22213311111111114222222-22222122-------------------------21111--1--- ------1-----1----------------------------1-----1---1---1----111-1--1----------1---1-----2222-111---11--1--11-------------------------------11-----1-1---1----------------1-------------12111---1111111111111111111-1111111211-1111111112-122222222222222111111-1-22-------111211----22222211111111111111111122222222222222331113331-11-3-------3-42---122211112111------------111-111-----------------1----------------------------1--1----------------11-----111---------11------------------------------------------------------------------------------------------------1--------------111---------------1---1-----1--1-----------1-1111111-------441---11-222324322432242544484--1----11-11132223322222222222-2222222222222222222222222222323232223232332222222221-22222222222211--11111------11-222222122222222----------1------------------111111111-2544444444434411---------------3--------------12-----1-11-1111---1-1111111-21---3----1- 11--11--1----------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 241 STR:RPRED 100.0 SQ:SECSTR ccccTcccccHHHHTcEEEEEccHHHHHHHHTTcEEEEEEEEETTEEEEEEEETTEEEEEEcccccHHHHHHHHHHHHHHTccEEEEEEEEEEccTTccTTcEEEEEEEEEEccGGGGTccTTccEEccHHHHHHHHHHHHHHTccEEEEEEEEEccccGGGTTHHHHHHHTTccEEEccHHHHHHHHHTTTcEEEEEEEEEEETTTcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 241-242| PSIPRED ccccccccccHHHcccEEEEcccHHHHHHHHHHcccEEEEEEEccEEEEEEEEccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEEEcccccccccEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEEccccccccHHHHHHHHHccccEEEccHHHHHHHHHHHcccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //