[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Halorubrum lacusprofundi ATCC 49239 (hlac0)
Chromosome : 2
Gene : ACM58376.1
DDBJ      :             integrase family protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
d.163.1
:205 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->202 1a0pA PDBj 2e-05 27.8 %
:RPS:PDB   12->202 1ae9A PDBj 8e-14 14.2 %
:RPS:SCOP  14->201 1a0pA2  d.163.1.1 * 2e-15 24.6 %
:HMM:SCOP  8->205 4crxA2 d.163.1.1 * 2.1e-28 26.7 %
:RPS:PFM   19->202 PF00589 * Phage_integrase 9e-10 37.3 %
:HMM:PFM   14->204 PF00589 * Phage_integrase 8.8e-27 29.3 167/173  
:BLT:SWISS 4->202 XERC_BIFLD 3e-12 35.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACM58376.1 GT:GENE ACM58376.1 GT:PRODUCT integrase family protein GT:DATABASE GIB00862CH02 GT:ORG hlac0 GB:ACCESSION GIB00862CH02 GB:CHROMOSOME 2 GB:LOCATION 69792..70409 GB:FROM 69792 GB:TO 70409 GB:DIRECTION + GB:PRODUCT integrase family protein GB:NOTE PFAM: integrase family protein; KEGG: blj:BLD_0251 integrase GB:PROTEIN_ID ACM58376.1 GB:DB_XREF GI:222454112 InterPro:IPR002104 LENGTH 205 SQ:AASEQ MTNSADSKVRAKVWVTPEQVEALRSACYTAGAEYLQQRNEAITAFAYDTGLRVGELVQVDVSLLRSNNSELYLPTEIQKDYPNENSPPPVTLELADETARLLSAYLTNRWKDTPALFPSRSSNRISEQGVRNMLHKVAEAADVRPYKLDGSRGDAGDVTPHALRHGVAYRMMNEEEDNTLYDVRNRLRHRSIQTTERIYDHLLKV GT:EXON 1|1-205:0| BL:SWS:NREP 1 BL:SWS:REP 4->202|XERC_BIFLD|3e-12|35.0|177/355| BL:PDB:NREP 1 BL:PDB:REP 35->202|1a0pA|2e-05|27.8|144/271| RP:PDB:NREP 1 RP:PDB:REP 12->202|1ae9A|8e-14|14.2|169/171| RP:PFM:NREP 1 RP:PFM:REP 19->202|PF00589|9e-10|37.3|158/168|Phage_integrase| HM:PFM:NREP 1 HM:PFM:REP 14->204|PF00589|8.8e-27|29.3|167/173|Phage_integrase| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF00589|IPR002104| GO:PFM GO:0006310|"GO:DNA recombination"|PF00589|IPR002104| GO:PFM GO:0015074|"GO:DNA integration"|PF00589|IPR002104| RP:SCP:NREP 1 RP:SCP:REP 14->201|1a0pA2|2e-15|24.6|171/180|d.163.1.1| HM:SCP:REP 8->205|4crxA2|2.1e-28|26.7|191/212|d.163.1.1|1/1|DNA breaking-rejoining enzymes| OP:NHOMO 20 OP:NHOMOORG 14 OP:PATTERN ------------------------------3------------------------------------- -----------------------------------------------------2---------------------111------------------------------------------------------------------1---------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------1---1------------------------1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------4- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 194 STR:RPRED 94.6 SQ:SECSTR #########cccccccHHHHHHHHHHGGGccccHHHHHHHHHHHHHHHHcccHHHHHHccGGGEETTEEEEEcTTTccEEEEETTcEEGGGTEEHHHHHHHHHcTTTcHHTccccccccTTcccccHHHHHHHHHHHHHHHccccccHHHTcccccccccTTHHHHHHHHHHHHHTcTcHHHHHHHHTccEEcccHcEEEEcH## DISOP:02AL 204-206| PSIPRED ccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHcccHHHEEccccEEEEEEEcccccccccccccEEEEccHHHHHHHHHHHHHcccccccEEEccccccccHHHHHHHHHHHHHHccccHHHHHccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHcc //