[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0016
DDBJ      :             KIAA0016
Swiss-Prot:TOM20_PONAB  RecName: Full=Mitochondrial import receptor subunit TOM20 homolog;AltName: Full=Mitochondrial 20 kDa outer membrane protein;AltName: Full=Outer mitochondrial membrane receptor Tom20;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  62/199 : Viruses  0/175   --->[See Alignment]
a.23.4
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   84->178 1om2A PDBj 1e-35 97.9 %
:RPS:SCOP  84->178 1om2A  a.23.4.1 * 7e-38 77.9 %
:HMM:SCOP  84->178 1om2A_ a.23.4.1 * 1.1e-33 57.6 %
:RPS:PFM   40->120 PF02064 * MAS20 1e-19 58.0 %
:HMM:PFM   34->86 PF02064 * MAS20 1.7e-12 43.4 53/183  
:HMM:PFM   99->157 PF02064 * MAS20 4.6e-05 20.3 59/183  
:BLT:SWISS 34->178 TOM20_PONAB 4e-66 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0016 GT:ORG huge0 GT:GENE KIAA0016 GT:PRODUCT KIAA0016 GT:DATABASE huge2038 LENGTH 178 SQ:AASEQ PSGVSCADRSEGSWPTAPSRSLPPPSTLSVVEKMVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE SW:ID TOM20_PONAB SW:DE RecName: Full=Mitochondrial import receptor subunit TOM20 homolog;AltName: Full=Mitochondrial 20 kDa outer membrane protein;AltName: Full=Outer mitochondrial membrane receptor Tom20; SW:GN Name=TOMM20; SW:KW Membrane; Mitochondrion; Mitochondrion outer membrane; Phosphoprotein;Protein transport; Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 34->178|TOM20_PONAB|4e-66|100.0|145/145| GO:SWS:NREP 6 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0005739|"GO:mitochondrion"|Mitochondrion| GO:SWS GO:0005741|"GO:mitochondrial outer membrane"|Mitochondrion outer membrane| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| SEG 15->29|ptapsrslpppstls| SEG 135->153|qpqqllqvlqqtlpppvfq| BL:PDB:NREP 1 BL:PDB:REP 84->178|1om2A|1e-35|97.9|95/95| RP:PFM:NREP 1 RP:PFM:REP 40->120|PF02064|1e-19|58.0|81/155|MAS20| HM:PFM:NREP 2 HM:PFM:REP 34->86|PF02064|1.7e-12|43.4|53/183|MAS20| HM:PFM:REP 99->157|PF02064|4.6e-05|20.3|59/183|MAS20| GO:PFM:NREP 3 GO:PFM GO:0005742|"GO:mitochondrial outer membrane translocase complex"|PF02064|IPR002056| GO:PFM GO:0006605|"GO:protein targeting"|PF02064|IPR002056| GO:PFM GO:0006886|"GO:intracellular protein transport"|PF02064|IPR002056| RP:SCP:NREP 1 RP:SCP:REP 84->178|1om2A|7e-38|77.9|95/95|a.23.4.1| HM:SCP:REP 84->178|1om2A_|1.1e-33|57.6|92/95|a.23.4.1|1/1|Mitochondrial import receptor subunit Tom20| OP:NHOMO 96 OP:NHOMOORG 62 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------1--2242121121311122-3-252123211-2111231211111131112111-1111121111121------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 53.4 SQ:SECSTR ###################################################################################ccccccccccccHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHTTTccccc DISOP:02AL 1-4,6-7,71-94,172-172,174-179| PSIPRED cccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcHHcccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHccc //