[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0026
DDBJ      :             KIAA0026
Swiss-Prot:MO4L2_PONAB  RecName: Full=Mortality factor 4-like protein 2;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  171/199 : Viruses  0/175   --->[See Alignment]
b.34.13
:288 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   121->286 2f5jB PDBj 5e-80 90.6 %
:RPS:PDB   120->286 2aqlA PDBj 3e-68 89.9 %
:HMM:SCOP  72->142 1wgsA_ b.34.13.3 * 0.00025 28.1 %
:RPS:PFM   99->274 PF05712 * MRG 2e-35 46.0 %
:HMM:PFM   101->276 PF05712 * MRG 3.3e-57 43.9 171/196  
:BLT:SWISS 1->288 MO4L2_PONAB e-167 100.0 %

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0026 GT:ORG huge0 GT:GENE KIAA0026 GT:PRODUCT KIAA0026 GT:DATABASE huge2038 LENGTH 288 SQ:AASEQ MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL SW:ID MO4L2_PONAB SW:DE RecName: Full=Mortality factor 4-like protein 2; SW:GN Name=MORF4L2; SW:KW Chromatin regulator; DNA damage; DNA repair; Growth regulation;Nucleus; Phosphoprotein; Transcription; Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->288|MO4L2_PONAB|e-167|100.0|288/288| GO:SWS:NREP 7 GO:SWS GO:0016568|"GO:chromatin modification"|Chromatin regulator| GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0040008|"GO:regulation of growth"|Growth regulation| GO:SWS GO:0005634|"GO:nucleus"|Nucleus| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 121->286|2f5jB|5e-80|90.6|159/159| RP:PDB:NREP 1 RP:PDB:REP 120->286|2aqlA|3e-68|89.9|158/158| RP:PFM:NREP 1 RP:PFM:REP 99->274|PF05712|2e-35|46.0|176/206|MRG| HM:PFM:NREP 1 HM:PFM:REP 101->276|PF05712|3.3e-57|43.9|171/196|MRG| GO:PFM:NREP 1 GO:PFM GO:0005634|"GO:nucleus"|PF05712|IPR008676| HM:SCP:REP 72->142|1wgsA_|0.00025|28.1|57/0|b.34.13.3|1/1|Chromo domain-like| OP:NHOMO 323 OP:NHOMOORG 171 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----111-----1121111111111111112111111111111111111-1111-1111111111111-11111-11111-1111111-11111222111121221-12-2332211212213277272JP4133422124125222212222L2212122411111111--2111-11-----12233123--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 57.3 SQ:SECSTR #######################################################################################################################cccccccGGGHHHHHHHHHHHHTccEEEcccccccHHHHHHHHHHHcTTc##HHHccHHHHHHHHHHHHHHHHHTTTTcccGGGHHHHHHHHHHcTTccGGGTccHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHHHHHHHHTHHHHccGGGEEEccHHHHTc## DISOP:02AL 1-114,168-174| PSIPRED cccHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccEEEEccHHHHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccHHHHHccc //