[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0038
DDBJ      :             KIAA0038
Swiss-Prot:IF4H_PONAB   RecName: Full=Eukaryotic translation initiation factor 4H;         Short=eIF-4H;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  138/199 : Viruses  0/175   --->[See Alignment]
d.58.7
:230 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->119 2dngA PDBj 1e-45 100.0 %
:RPS:PDB   35->118 2dngA PDBj 1e-10 98.8 %
:RPS:SCOP  47->119 1cvjA1  d.58.7.1 * 4e-14 26.0 %
:HMM:SCOP  32->152 1h2tZ_ d.58.7.1 * 1.7e-21 33.9 %
:RPS:PFM   47->113 PF00076 * RRM_1 1e-06 38.8 %
:HMM:PFM   47->114 PF00076 * RRM_1 8.6e-16 38.8 67/70  
:HMM:PFM   174->227 PF06273 * eIF-4B 0.00021 44.0 50/490  
:BLT:SWISS 3->230 IF4H_PONAB 9e-88 98.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0038 GT:ORG huge0 GT:GENE KIAA0038 GT:PRODUCT KIAA0038 GT:DATABASE huge2038 LENGTH 230 SQ:AASEQ RQMADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE SW:ID IF4H_PONAB SW:DE RecName: Full=Eukaryotic translation initiation factor 4H; Short=eIF-4H; SW:GN Name=EIF4H; SW:KW Acetylation; Cytoplasm; Initiation factor; Phosphoprotein;Protein biosynthesis; RNA-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 3->230|IF4H_PONAB|9e-88|98.7|228/228| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003743|"GO:translation initiation factor activity"|Initiation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| SEG 15->34|ssfgggrgsrgsagghgsrs| SEG 120->161|grkqdkggfgfrkggpddrgfrddflggrggsrpgdrrtgpp| BL:PDB:NREP 1 BL:PDB:REP 36->119|2dngA|1e-45|100.0|84/103| RP:PDB:NREP 1 RP:PDB:REP 35->118|2dngA|1e-10|98.8|84/103| RP:PFM:NREP 1 RP:PFM:REP 47->113|PF00076|1e-06|38.8|67/71|RRM_1| HM:PFM:NREP 2 HM:PFM:REP 47->114|PF00076|8.6e-16|38.8|67/70|RRM_1| HM:PFM:REP 174->227|PF06273|0.00021|44.0|50/490|eIF-4B| GO:PFM:NREP 1 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00076|IPR000504| RP:SCP:NREP 1 RP:SCP:REP 47->119|1cvjA1|4e-14|26.0|73/80|d.58.7.1| HM:SCP:REP 32->152|1h2tZ_|1.7e-21|33.9|118/0|d.58.7.1|1/1|RNA-binding domain, RBD| OP:NHOMO 213 OP:NHOMOORG 140 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------1-----11111111111-1111111111111111111111111111111-1-1111------------1-----------11-111122211111-1111-1-14252283111111123221293121311-21-2--122-2112212222232123124144--22----111111----111---11-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 37.0 SQ:SECSTR ##################################cccccccccEEEEEEcccTTccHHHHHHHHGGGcEEEEEEEEcTTTccEEEEEEEEEccHHHHHHHHHHTTcEETTEEcEEEEcc############################################################################################################### DISOP:02AL 1-6,8-45,118-231| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHcccEEEEEEEEcccccccccEEEEEEccHHHHHHHHHHcccEEccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccHHHHHHHHcc //