[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0040
DDBJ      :             KIAA0040
Swiss-Prot:K0040_HUMAN  RecName: Full=Uncharacterized protein KIAA0040;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:164 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 12->164 K0040_HUMAN 2e-84 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0040 GT:ORG huge0 GT:GENE KIAA0040 GT:PRODUCT KIAA0040 GT:DATABASE huge2038 LENGTH 164 SQ:AASEQ PHTDISGTPEIMHYVHVHRVTTQPRNKPQTKCPSGGQSQGPRGQFLDTVLAAMCPIAMLLTADPGMPPTCLWHTPHAKHKEHLSIHLNMVPKCVHMHVTHTHTNSGSRYVGKYILLIKWSLAMYFVQGSTLSTVTKMSHGKALPDSDTYIQFPNQQGPHTPSIP SW:ID K0040_HUMAN SW:DE RecName: Full=Uncharacterized protein KIAA0040; SW:GN Name=KIAA0040; SW:KW Complete proteome; Polymorphism. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 12->164|K0040_HUMAN|2e-84|100.0|153/153| TM:NTM 2 TM:REGION 44->66| TM:REGION 107->129| SEG 33->44|psggqsqgprgq| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------2-1------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,23-43,156-165| PSIPRED ccccccccHHHEEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccEEEEEEEEcccEEEEEEEEEEcccccEEEEEEEEEEEEEEEEEEEEcccHHHHHHHcccccccccccEEEccccccccccccc //