[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0059
DDBJ      :             KIAA0059
Swiss-Prot:ABLM1_HUMAN  RecName: Full=Actin-binding LIM protein 1;AltName: Full=Actin-binding LIM protein family member 1;         Short=abLIM-1;AltName: Full=Actin-binding double zinc finger protein;AltName: Full=LIMAB1;AltName: Full=Limatin;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
a.14.1d.217.1e.59.1g.39.1
:724 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   45->92 1x64A PDBj 1e-07 39.6 %
:BLT:PDB   94->156 1v6gA PDBj 6e-29 71.4 %
:BLT:PDB   170->228 2dj7A PDBj 8e-24 69.5 %
:BLT:PDB   231->290 1wigA PDBj 2e-25 68.3 %
:BLT:PDB   656->724 1ujsA PDBj 1e-23 63.8 %
:RPS:PDB   44->133 2cupA PDBj 6e-14 25.6 %
:RPS:PDB   166->260 2cupA PDBj 1e-12 24.2 %
:RPS:PDB   236->284 2bq4B PDBj 2e-04 6.1 %
:RPS:SCOP  30->92 1oqjA  d.217.1.1 * 7e-07 10.0 %
:RPS:SCOP  71->110 2d8yA2  g.39.1.3 * 2e-09 17.5 %
:RPS:SCOP  86->128 1x64A1  g.39.1.3 * 6e-12 27.9 %
:RPS:SCOP  128->162 1v6gA2  g.39.1.3 * 6e-04 62.9 %
:RPS:SCOP  139->234 2fiyA1  e.59.1.1 * 3e-08 23.1 %
:RPS:SCOP  211->254 1x64A1  g.39.1.3 * 2e-13 25.0 %
:RPS:SCOP  257->295 1wigA2  g.39.1.3 * 2e-17 59.0 %
:RPS:SCOP  655->724 1ujsA  a.14.1.1 * 1e-31 62.9 %
:HMM:SCOP  25->69 1x64A1 g.39.1.3 * 1.3e-07 28.6 %
:HMM:SCOP  70->134 1b8tA2 g.39.1.3 * 3e-19 47.7 %
:HMM:SCOP  128->167 1v6gA2 g.39.1.3 * 3.4e-15 57.5 %
:HMM:SCOP  162->197 2dj7A2 g.39.1.3 * 8.3e-09 38.9 %
:HMM:SCOP  198->261 1b8tA2 g.39.1.3 * 1.2e-20 45.3 %
:HMM:SCOP  256->296 1wigA2 g.39.1.3 * 1.3e-12 53.7 %
:HMM:SCOP  643->724 1ujsA_ a.14.1.1 * 5.2e-28 48.8 %
:RPS:PFM   45->92 PF00412 * LIM 6e-08 44.9 %
:RPS:PFM   104->155 PF00412 * LIM 3e-08 45.3 %
:RPS:PFM   172->223 PF00412 * LIM 3e-11 48.1 %
:RPS:PFM   689->724 PF02209 * VHP 2e-08 55.6 %
:HMM:PFM   45->99 PF00412 * LIM 7.1e-13 32.7 55/58  
:HMM:PFM   104->155 PF00412 * LIM 2.2e-13 29.4 51/58  
:HMM:PFM   172->225 PF00412 * LIM 8.1e-18 46.3 54/58  
:HMM:PFM   231->273 PF00412 * LIM 1.2e-09 33.3 42/58  
:HMM:PFM   689->724 PF02209 * VHP 2.3e-19 50.0 36/36  
:BLT:SWISS 28->724 ABLM1_HUMAN 0.0 99.7 %
:PROS 45->78|PS00478|LIM_DOMAIN_1
:PROS 104->137|PS00478|LIM_DOMAIN_1
:PROS 172->206|PS00478|LIM_DOMAIN_1
:PROS 231->264|PS00478|LIM_DOMAIN_1
:REPEAT 4|45->99|104->159|172->218|231->286
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0059 GT:ORG huge0 GT:GENE KIAA0059 GT:PRODUCT KIAA0059 GT:DATABASE huge2038 LENGTH 724 SQ:AASEQ NPGALCMLMTLEMTELTDPHHTMGDYKVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAALAAQSKSSEDIIKFSKFPAAQAPDPSETPEIETDHWPGPPSFAVIGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF SW:ID ABLM1_HUMAN SW:DE RecName: Full=Actin-binding LIM protein 1;AltName: Full=Actin-binding LIM protein family member 1; Short=abLIM-1;AltName: Full=Actin-binding double zinc finger protein;AltName: Full=LIMAB1;AltName: Full=Limatin; SW:GN Name=ABLIM1; Synonyms=ABLIM, KIAA0059, LIMAB1; SW:KW Actin-binding; Alternative splicing; Coiled coil; Complete proteome;Cytoplasm; Cytoskeleton; LIM domain; Metal-binding; Phosphoprotein;Polymorphism; Repeat; Zinc. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 28->724|ABLM1_HUMAN|0.0|99.7|697/778| GO:SWS:NREP 4 GO:SWS GO:0003779|"GO:actin binding"|Actin-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005856|"GO:cytoskeleton"|Cytoskeleton| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 45->78|PS00478|LIM_DOMAIN_1|PDOC00382| PROS 104->137|PS00478|LIM_DOMAIN_1|PDOC00382| PROS 172->206|PS00478|LIM_DOMAIN_1|PDOC00382| PROS 231->264|PS00478|LIM_DOMAIN_1|PDOC00382| NREPEAT 1 REPEAT 4|45->99|104->159|172->218|231->286| SEG 7->17|mlmtlemtelt| SEG 306->315|pgssipgspg| SEG 535->553|reeddeellrrrqlqeeql| SEG 565->583|lkeemekesrerssllasr| BL:PDB:NREP 5 BL:PDB:REP 45->92|1x64A|1e-07|39.6|48/89| BL:PDB:REP 94->156|1v6gA|6e-29|71.4|63/81| BL:PDB:REP 170->228|2dj7A|8e-24|69.5|59/80| BL:PDB:REP 231->290|1wigA|2e-25|68.3|60/73| BL:PDB:REP 656->724|1ujsA|1e-23|63.8|69/88| RP:PDB:NREP 3 RP:PDB:REP 44->133|2cupA|6e-14|25.6|90/101| RP:PDB:REP 166->260|2cupA|1e-12|24.2|95/101| RP:PDB:REP 236->284|2bq4B|2e-04|6.1|49/115| RP:PFM:NREP 4 RP:PFM:REP 45->92|PF00412|6e-08|44.9|48/57|LIM| RP:PFM:REP 104->155|PF00412|3e-08|45.3|51/57|LIM| RP:PFM:REP 172->223|PF00412|3e-11|48.1|52/57|LIM| RP:PFM:REP 689->724|PF02209|2e-08|55.6|36/36|VHP| HM:PFM:NREP 5 HM:PFM:REP 45->99|PF00412|7.1e-13|32.7|55/58|LIM| HM:PFM:REP 104->155|PF00412|2.2e-13|29.4|51/58|LIM| HM:PFM:REP 172->225|PF00412|8.1e-18|46.3|54/58|LIM| HM:PFM:REP 231->273|PF00412|1.2e-09|33.3|42/58|LIM| HM:PFM:REP 689->724|PF02209|2.3e-19|50.0|36/36|VHP| GO:PFM:NREP 5 GO:PFM GO:0008270|"GO:zinc ion binding"|PF00412|IPR001781| GO:PFM GO:0008270|"GO:zinc ion binding"|PF00412|IPR001781| GO:PFM GO:0008270|"GO:zinc ion binding"|PF00412|IPR001781| GO:PFM GO:0003779|"GO:actin binding"|PF02209|IPR003128| GO:PFM GO:0007010|"GO:cytoskeleton organization"|PF02209|IPR003128| RP:SCP:NREP 8 RP:SCP:REP 30->92|1oqjA|7e-07|10.0|61/90|d.217.1.1| RP:SCP:REP 71->110|2d8yA2|2e-09|17.5|40/42|g.39.1.3| RP:SCP:REP 86->128|1x64A1|6e-12|27.9|43/45|g.39.1.3| RP:SCP:REP 128->162|1v6gA2|6e-04|62.9|35/40|g.39.1.3| RP:SCP:REP 139->234|2fiyA1|3e-08|23.1|78/285|e.59.1.1| RP:SCP:REP 211->254|1x64A1|2e-13|25.0|44/45|g.39.1.3| RP:SCP:REP 257->295|1wigA2|2e-17|59.0|39/41|g.39.1.3| RP:SCP:REP 655->724|1ujsA|1e-31|62.9|70/88|a.14.1.1| HM:SCP:REP 25->69|1x64A1|1.3e-07|28.6|42/0|g.39.1.3|1/5|Glucocorticoid receptor-like (DNA-binding domain)| HM:SCP:REP 70->134|1b8tA2|3e-19|47.7|65/65|g.39.1.3|2/4|Glucocorticoid receptor-like (DNA-binding domain)| HM:SCP:REP 128->167|1v6gA2|3.4e-15|57.5|40/40|g.39.1.3|1/2|Glucocorticoid receptor-like (DNA-binding domain)| HM:SCP:REP 162->197|2dj7A2|8.3e-09|38.9|36/0|g.39.1.3|3/5|Glucocorticoid receptor-like (DNA-binding domain)| HM:SCP:REP 198->261|1b8tA2|1.2e-20|45.3|64/65|g.39.1.3|4/4|Glucocorticoid receptor-like (DNA-binding domain)| HM:SCP:REP 256->296|1wigA2|1.3e-12|53.7|41/0|g.39.1.3|2/2|Glucocorticoid receptor-like (DNA-binding domain)| HM:SCP:REP 643->724|1ujsA_|5.2e-28|48.8|82/88|a.14.1.1|1/1|VHP, Villin headpiece domain| OP:NHOMO 3274 OP:NHOMOORG 166 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----883-----35433223223221243244434322131233232121122121322111311-12-11-1-11----11111132-11232111212-22584-F3-U*****pRPPMUlS**L*O***4*v*MRWRzSYobBfUSNnMF*RfcYaFRUZJHJC*LJ*CPKB1---7-----41132-1---2111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 338 STR:RPRED 46.7 SQ:SECSTR #######################ccccccccccccccccccccccccccccccccEEEETTEEEETTTcccccccccTTccccEEETTEEEcHHHHTTccccccccccccccccEEEccccEEETTTcccTTcTGGGGGGcccHHHHHTTcTTccccccccccccccTTcccccccccTTcccTTcHHHHHHcccTTcHHHHHHHHTHHTTcccccccHHHHHHHHTTcccccccccccccEEEccccEEETTTcccTTcTGGGGGGcccHHHHHTTcTTccccHHHccc###########################################################################################################################################################################################################################################################################################################################################################################ccccccccccTTTTcccTTTTccccccccTTTGGGGccTTHHHHHHcccHHHHTTccHHHHHHHHHHTTcc DISOP:02AL 1-1,30-41,290-319,354-554,564-611,617-656,658-658| PSIPRED ccccccEEEEEEcccccccccccccccccccccccccccccccccHHcccEEEcHHEEEccEEEcccccEEccccccccccccEEEccEEEcccccHHHcccccccccccccccEEEEcccccccccccccccccccccccEEEEccccEEccccccccccccccccccccccccccccccccEEEEccccccccccEEcccccccccEEEEEccEEEHHHHHHHHcccccccccccccHHEEEEccEEcccccccHHHcccccccccEEEEcccEEEcHHHHHHHHccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccHHHccccccccccccccccHHHHHHcccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccc //