[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0063
DDBJ      :             KIAA0063
Swiss-Prot:JOS1_PONAB   RecName: Full=Josephin-1;AltName: Full=Josephin domain-containing protein 1;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  74/199 : Viruses  0/175   --->[See Alignment]
:211 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->172 2agaA PDBj 6e-09 33.8 %
:RPS:PDB   33->57 2dosA PDBj 5e-04 52.0 %
:RPS:PFM   39->173 PF02099 * Josephin 8e-28 48.8 %
:HMM:PFM   39->186 PF02099 * Josephin 1.5e-28 34.8 132/158  
:BLT:SWISS 10->211 JOS1_PONAB e-114 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0063 GT:ORG huge0 GT:GENE KIAA0063 GT:PRODUCT KIAA0063 GT:DATABASE huge2038 LENGTH 211 SQ:AASEQ PSLEPKTKNMSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV SW:ID JOS1_PONAB SW:DE RecName: Full=Josephin-1;AltName: Full=Josephin domain-containing protein 1; SW:GN Name=JOSD1; SW:KW SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 10->211|JOS1_PONAB|e-114|100.0|202/202| SEG 192->202|elllvvpeeve| BL:PDB:NREP 1 BL:PDB:REP 28->172|2agaA|6e-09|33.8|130/190| RP:PDB:NREP 1 RP:PDB:REP 33->57|2dosA|5e-04|52.0|25/171| RP:PFM:NREP 1 RP:PFM:REP 39->173|PF02099|8e-28|48.8|129/166|Josephin| HM:PFM:NREP 1 HM:PFM:REP 39->186|PF02099|1.5e-28|34.8|132/158|Josephin| OP:NHOMO 122 OP:NHOMOORG 74 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----11-------------------------------------------------------------------------------------------------1------2222421211-22262-2177212121111321241211-1211211221131-11-111--111-1------1-1111-111111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 62.1 SQ:SECSTR ###########################cccGGcccccccccccccHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHTcccccccccccccTHHHHHHHHHHTcEEEEcccHHHHHHcccTTccEEEEEc##############cccEEEEEEETTEEEEEccTTcccEEE####################################### DISOP:02AL 1-4,7-7,17-35,210-212| PSIPRED ccccccccccccccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHccccccccccccEEHHHHHHHHHHcccEEEEccccccHHHccHHHHHHHHHcccccccccccccccccEEEEEEEEEccEEEEEccccccccccccHHHHHHHHHHHHcccccEEEEEEcccccccccccccc //