[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0069
DDBJ      :             KIAA0069
Swiss-Prot:AR6P1_HUMAN  RecName: Full=ADP-ribosylation factor-like protein 6-interacting protein 1;         Short=ARL-6-interacting protein 1;         Short=Aip-1;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  50/199 : Viruses  0/175   --->[See Alignment]
:226 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   57->216 PF02453 * Reticulon 2.3e-32 23.1 156/164  
:BLT:SWISS 24->214 AR6P1_HUMAN e-101 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0069 GT:ORG huge0 GT:GENE KIAA0069 GT:PRODUCT KIAA0069 GT:DATABASE huge2038 LENGTH 226 SQ:AASEQ VRVSVGGLVGEVACACRDCIPETMAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE SW:ID AR6P1_HUMAN SW:DE RecName: Full=ADP-ribosylation factor-like protein 6-interacting protein 1; Short=ARL-6-interacting protein 1; Short=Aip-1; SW:GN Name=ARL6IP1; Synonyms=ARL6IP, KIAA0069; SW:KW Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 24->214|AR6P1_HUMAN|e-101|100.0|191/203| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 5 TM:REGION 1->23| TM:REGION 65->87| TM:REGION 93->115| TM:REGION 160->182| TM:REGION 184->206| SEG 181->194|llltylivtsllll| SEG 215->225|nkllkqkekkn| HM:PFM:NREP 1 HM:PFM:REP 57->216|PF02453|2.3e-32|23.1|156/164|Reticulon| OP:NHOMO 61 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------2112111-211-1111111181111211111-11-1111-1111111111--1111-1------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,25-25,216-227| PSIPRED cEEEHHHHHHHHHHHHcccccHHHHccccHHHHHHHHHHHHHHHHHccHHHHHEEcccEEEEccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcc //