[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0071
DDBJ      :             KIAA0071
Swiss-Prot:RCOR1_HUMAN  RecName: Full=REST corepressor 1;AltName: Full=Protein CoREST;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  63/199 : Viruses  0/175   --->[See Alignment]
a.4.1
:396 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   106->155 2yqkA PDBj 1e-06 40.0 %
:BLT:PDB   222->355 2uxxB PDBj 7e-65 100.0 %
:RPS:PDB   104->163 2crgA PDBj 2e-09 35.0 %
:RPS:PDB   296->343 2cu7A PDBj 7e-07 37.5 %
:RPS:SCOP  104->150 2crgA1  a.4.1.3 * 2e-15 44.7 %
:RPS:SCOP  290->354 2iw5B1  a.4.1.3 * 3e-10 100.0 %
:HMM:SCOP  87->154 1xc5A1 a.4.1.3 * 2.7e-12 23.5 %
:HMM:SCOP  278->345 1xc5A1 a.4.1.3 * 1.3e-12 26.5 %
:RPS:PFM   16->68 PF01448 * ELM2 1e-08 46.2 %
:HMM:PFM   105->148 PF00249 * Myb_DNA-binding 1.5e-07 15.9 44/48  
:HMM:PFM   296->339 PF00249 * Myb_DNA-binding 1.8e-11 34.1 44/48  
:HMM:PFM   16->70 PF01448 * ELM2 1.2e-15 29.6 54/55  
:BLT:SWISS 16->396 RCOR1_HUMAN 0.0 100.0 %
:REPEAT 2|106->149|297->340
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0071 GT:ORG huge0 GT:GENE KIAA0071 GT:PRODUCT KIAA0071 GT:DATABASE huge2038 LENGTH 396 SQ:AASEQ GSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS SW:ID RCOR1_HUMAN SW:DE RecName: Full=REST corepressor 1;AltName: Full=Protein CoREST; SW:GN Name=RCOR1; Synonyms=KIAA0071, RCOR; SW:KW 3D-structure; Chromatin regulator; Coiled coil; Complete proteome;Host-virus interaction; Nucleus; Phosphoprotein; Repeat; Repressor;Transcription; Transcription regulation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 16->396|RCOR1_HUMAN|0.0|100.0|381/482| GO:SWS:NREP 5 GO:SWS GO:0016568|"GO:chromatin modification"|Chromatin regulator| GO:SWS GO:0044419|"GO:interspecies interaction between organisms"|Host-virus interaction| GO:SWS GO:0005634|"GO:nucleus"|Nucleus| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| NREPEAT 1 REPEAT 2|106->149|297->340| SEG 1->15|gssgsssdeehgggg| SEG 167->177|ereesedelee| SEG 235->248|veavsanataattv| BL:PDB:NREP 2 BL:PDB:REP 106->155|2yqkA|1e-06|40.0|50/63| BL:PDB:REP 222->355|2uxxB|7e-65|100.0|134/134| RP:PDB:NREP 2 RP:PDB:REP 104->163|2crgA|2e-09|35.0|60/70| RP:PDB:REP 296->343|2cu7A|7e-07|37.5|48/72| RP:PFM:NREP 1 RP:PFM:REP 16->68|PF01448|1e-08|46.2|52/55|ELM2| HM:PFM:NREP 3 HM:PFM:REP 105->148|PF00249|1.5e-07|15.9|44/48|Myb_DNA-binding| HM:PFM:REP 296->339|PF00249|1.8e-11|34.1|44/48|Myb_DNA-binding| HM:PFM:REP 16->70|PF01448|1.2e-15|29.6|54/55|ELM2| RP:SCP:NREP 2 RP:SCP:REP 104->150|2crgA1|2e-15|44.7|47/57|a.4.1.3| RP:SCP:REP 290->354|2iw5B1|3e-10|100.0|65/65|a.4.1.3| HM:SCP:REP 87->154|1xc5A1|2.7e-12|23.5|68/0|a.4.1.3|1/2|Homeodomain-like| HM:SCP:REP 278->345|1xc5A1|1.3e-12|26.5|68/0|a.4.1.3|2/2|Homeodomain-like| OP:NHOMO 377 OP:NHOMOORG 63 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------397464A2343465U7385Ph8385D33447346725333632B47667-1-2312284551321------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 224 STR:RPRED 56.6 SQ:SECSTR #####################################################################################################ccccccHHHHHHHHHHHHHTcccHHHHHHTcccccHHHHHHHHHHHHTcccccccccccccccc########################################################ccccTTccccHHHHHHHcccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTTGGGccccccccccccccHHHHHHHHHHHHHTcccHHHHHHHHccccHHHHHHHHHHHHHHHcccHTHHHHHHHccccHHHHHHHHHHHHHHHHHcTTHHH############### DISOP:02AL 1-15,36-39,156-234,236-246,268-296,350-388,394-397| PSIPRED cccccccccccccccEEEcccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHcccccccHHHHHHHHHHcccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccccccc //