[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0081
DDBJ      :             KIAA0081
Swiss-Prot:MESD_HUMAN   RecName: Full=LDLR chaperone MESD;AltName: Full=Mesoderm development protein;AltName: Full=Mesoderm development candidate 2;AltName: Full=Renal carcinoma antigen NY-REN-61;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  56/199 : Viruses  0/175   --->[See Alignment]
:235 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   55->194 2rqmA PDBj 7e-70 95.0 %
:RPS:PFM   68->195 PF10185 * Mesd 2e-39 66.4 %
:HMM:PFM   52->223 PF10185 * Mesd 1.6e-84 72.4 145/158  
:BLT:SWISS 2->235 MESD_HUMAN e-100 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0081 GT:ORG huge0 GT:GENE KIAA0081 GT:PRODUCT KIAA0081 GT:DATABASE huge2038 LENGTH 235 SQ:AASEQ KMAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL SW:ID MESD_HUMAN SW:DE RecName: Full=LDLR chaperone MESD;AltName: Full=Mesoderm development protein;AltName: Full=Mesoderm development candidate 2;AltName: Full=Renal carcinoma antigen NY-REN-61;Flags: Precursor; SW:GN Name=MESDC2; Synonyms=KIAA0081, MESD; ORFNames=UNQ1911/PRO4369; SW:KW Chaperone; Complete proteome; Endoplasmic reticulum; Glycoprotein;Signal; Wnt signaling pathway. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 2->235|MESD_HUMAN|e-100|100.0|234/234| GO:SWS:NREP 2 GO:SWS GO:0005783|"GO:endoplasmic reticulum"|Endoplasmic reticulum| GO:SWS GO:0016055|"GO:Wnt receptor signaling pathway"|Wnt signaling pathway| TM:NTM 1 TM:REGION 11->31| SEG 20->30|llllllllppp| SEG 47->54|ppprkkkk| SEG 106->117|lkmtkkgktlmm| SEG 199->218|keknktkqdkgkkkkegdlk| BL:PDB:NREP 1 BL:PDB:REP 55->194|2rqmA|7e-70|95.0|140/141| RP:PFM:NREP 1 RP:PFM:REP 68->195|PF10185|2e-39|66.4|128/139|Mesd| HM:PFM:NREP 1 HM:PFM:REP 52->223|PF10185|1.6e-84|72.4|145/158|Mesd| OP:NHOMO 66 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------2-1111111111111111-24111121-111111111--11--21111112112111112-111------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 59.6 SQ:SECSTR ######################################################ccHHHHHHHHHHHHHHHHHHHHHHTTcccccccccccTHHHHHcccccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHHHHTTcccEEEEccTTEEEEEccccTTHHHHHHHHHTcTTccEEEEcccccccc######################################### DISOP:02AL 1-5,35-55,77-103,190-236| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHcccccccHHHHHHHHHHHHHccccccccccHHHcccccccHHHcccccHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEEEEcccEEEEEEEcccEEEEHHHHHHcccEEEEEEEccEEEccccccccccccccccHHHHHHHccccccccHHHHccccccccc //