[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0085
DDBJ      :             KIAA0085
Swiss-Prot:LAPM5_HUMAN  RecName: Full=Lysosomal-associated transmembrane protein 5;AltName: Full=Lysosomal-associated multitransmembrane protein 5;AltName: Full=Retinoic acid-inducible E3 protein;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  37/199 : Viruses  0/175   --->[See Alignment]
:269 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   98->266 PF03821 * Mtp 2e-20 43.2 %
:HMM:PFM   35->268 PF03821 * Mtp 2.2e-136 78.1 233/233  
:BLT:SWISS 8->269 LAPM5_HUMAN e-136 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0085 GT:ORG huge0 GT:GENE KIAA0085 GT:PRODUCT KIAA0085 GT:DATABASE huge2038 LENGTH 269 SQ:AASEQ RGGDGSTMDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRIADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAYLKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMPHNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEV SW:ID LAPM5_HUMAN SW:DE RecName: Full=Lysosomal-associated transmembrane protein 5;AltName: Full=Lysosomal-associated multitransmembrane protein 5;AltName: Full=Retinoic acid-inducible E3 protein; SW:GN Name=LAPTM5; Synonyms=KIAA0085; SW:KW Complete proteome; Lysosome; Membrane; Phosphoprotein; Polymorphism;Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 8->269|LAPM5_HUMAN|e-136|100.0|262/262| GO:SWS:NREP 4 GO:SWS GO:0005764|"GO:lysosome"|Lysosome| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 5 TM:REGION 24->46| TM:REGION 71->93| TM:REGION 99->121| TM:REGION 142->164| TM:REGION 191->213| SEG 111->118|llclltll| SEG 128->140|lklasrsrasssk| RP:PFM:NREP 1 RP:PFM:REP 98->266|PF03821|2e-20|43.2|155/170|Mtp| HM:PFM:NREP 1 HM:PFM:REP 35->268|PF03821|2.2e-136|78.1|233/233|Mtp| GO:PFM:NREP 2 GO:PFM GO:0006810|"GO:transport"|PF03821|IPR004687| GO:PFM GO:0016021|"GO:integral to membrane"|PF03821|IPR004687| OP:NHOMO 50 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------21-1111124-11271111111111-11--111111-2111-1--------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,266-270| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccHHHHHccccccccccccccccccc //