[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0087
DDBJ      :             KIAA0087
Swiss-Prot:K0087_HUMAN  RecName: Full=Uncharacterized protein KIAA0087;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
:165 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 28->165 K0087_HUMAN 1e-81 100.0 %

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0087 GT:ORG huge0 GT:GENE KIAA0087 GT:PRODUCT KIAA0087 GT:DATABASE huge2038 LENGTH 165 SQ:AASEQ IFDHDYAKKAPASSSVSQRPSGGTPGRMEAWESSQPLLRCEIPCPLPGTDRDGSVSLPGEAASCDLDTLEPEHGNRRVSGNPISVCWAYKVTKVKCWSVRERGGRHIGGPRSTLKHPAHHGMGKNLATSLPTAASLGLGKGQLLVSIRFMDTTKKRGQSETFNIC SW:ID K0087_HUMAN SW:DE RecName: Full=Uncharacterized protein KIAA0087; SW:GN Name=KIAA0087; ORFNames=HA1002; SW:KW Complete proteome; Phosphoprotein; Polymorphism. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 28->165|K0087_HUMAN|1e-81|100.0|138/138| OP:NHOMO 23 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------11-------1-112111111111-11--111---11---------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-29,159-161| PSIPRED ccccHHHHcccccccHHcccccccccccccccccccEEEEEcccccccccccccEEccccccccccccccccccccccccccEEEEEEEEEEEEEEEEEHHcccccccccHHHHHcHHHccccHHHHHHcccHHHccccccEEEEEEEEEccccccccccccccc //