[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0092
DDBJ      :             KIAA0092
Swiss-Prot:CEP57_HUMAN  RecName: Full=Centrosomal protein of 57 kDa;         Short=Cep57;AltName: Full=Testis-specific protein 57;AltName: Full=Translokin;AltName: Full=FGF2-interacting protein;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  56/199 : Viruses  0/175   --->[See Alignment]
:475 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   145->395 PF06657 * DUF1167 1e-50 60.5 %
:HMM:PFM   145->270 PF06657 * DUF1167 1.7e-50 58.9 124/273  
:HMM:PFM   269->395 PF06657 * DUF1167 1.2e-54 55.2 125/273  
:HMM:PFM   386->461 PF05272 * VirE 1.7e-05 18.9 74/198  
:BLT:SWISS 19->475 CEP57_HUMAN 0.0 96.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0092 GT:ORG huge0 GT:GENE KIAA0092 GT:PRODUCT KIAA0092 GT:DATABASE huge2038 LENGTH 475 SQ:AASEQ KMAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKQRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY SW:ID CEP57_HUMAN SW:DE RecName: Full=Centrosomal protein of 57 kDa; Short=Cep57;AltName: Full=Testis-specific protein 57;AltName: Full=Translokin;AltName: Full=FGF2-interacting protein; SW:GN Name=CEP57; Synonyms=KIAA0092, TSP57; SW:KW Alternative splicing; Coiled coil; Complete proteome; Cytoplasm;Cytoskeleton; Microtubule; Nucleus; Phosphoprotein; Polymorphism. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 19->475|CEP57_HUMAN|0.0|96.5|457/500| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005856|"GO:cytoskeleton"|Cytoskeleton| GO:SWS GO:0005874|"GO:microtubule"|Microtubule| GO:SWS GO:0005634|"GO:nucleus"|Nucleus| SEG 3->18|aaasvsaasgshlsns| SEG 212->224|qeleaklheeeqe| SEG 261->275|kkkkskppekstsps| SEG 397->419|qaqlekqklekqkkelkatkktl| SEG 460->471|qsiqnslqsssl| RP:PFM:NREP 1 RP:PFM:REP 145->395|PF06657|1e-50|60.5|243/263|DUF1167| HM:PFM:NREP 3 HM:PFM:REP 145->270|PF06657|1.7e-50|58.9|124/273|DUF1167| HM:PFM:REP 269->395|PF06657|1.2e-54|55.2|125/273|DUF1167| HM:PFM:REP 386->461|PF05272|1.7e-05|18.9|74/198|VirE| OP:NHOMO 157 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------32223231121222452727N3142521225-22322222222822322111112--------21------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-36,110-127,172-183,245-279,303-336,398-456| PSIPRED ccccHHHHHHcccHHcccccccccccccccccccccEEEcccccccccHHHHccccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHccHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHccHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHcccccccccHHHHHHHHHHHHHHHHHHHccccccc //