[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0101
DDBJ      :             KIAA0101
Swiss-Prot:PAF_HUMAN    RecName: Full=PCNA-associated factor;AltName: Full=p15PAF;AltName: Full=Overexpressed in anaplastic thyroid carcinoma 1;         Short=OEATC-1;AltName: Full=Hepatitis C virus NS5A-transactivated protein 9;         Short=HCV NS5A-transactivated protein 9;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  38/199 : Viruses  0/175   --->[See Alignment]
:130 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 20->130 PAF_HUMAN 7e-54 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0101 GT:ORG huge0 GT:GENE KIAA0101 GT:PRODUCT KIAA0101 GT:DATABASE huge2038 LENGTH 130 SQ:AASEQ NTLGWEVSSFSPLLSSCLNMVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE SW:ID PAF_HUMAN SW:DE RecName: Full=PCNA-associated factor;AltName: Full=p15PAF;AltName: Full=Overexpressed in anaplastic thyroid carcinoma 1; Short=OEATC-1;AltName: Full=Hepatitis C virus NS5A-transactivated protein 9; Short=HCV NS5A-transactivated protein 9; SW:GN Name=PAF; Synonyms=KIAA0101, NS5ATP9; ORFNames=L5; SW:KW Complete proteome; Mitochondrion; Nucleus; Phosphoprotein;Polymorphism. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 20->130|PAF_HUMAN|7e-54|100.0|111/111| GO:SWS:NREP 2 GO:SWS GO:0005739|"GO:mitochondrion"|Mitochondrion| GO:SWS GO:0005634|"GO:nucleus"|Nucleus| SEG 47->59|sstsatnstsvss| OP:NHOMO 42 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------11111111-1111112-1-13111111--1111-2111-11111----1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,41-67,90-131| PSIPRED cccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHcHHHHccccccccccccccccccccccccc //