[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0102
DDBJ      :             KIAA0102
Swiss-Prot:SPCS2_PONAB  RecName: Full=Signal peptidase complex subunit 2;         EC=3.4.-.-;AltName: Full=Microsomal signal peptidase 25 kDa subunit;         Short=SPase 25 kDa subunit;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  81/199 : Viruses  0/175   --->[See Alignment]
:225 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   55->218 PF06703 * SPC25 1e-35 48.7 %
:HMM:PFM   54->217 PF06703 * SPC25 2e-55 41.9 160/161  
:BLT:SWISS 31->225 SPCS2_PONAB e-113 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0102 GT:ORG huge0 GT:GENE KIAA0102 GT:PRODUCT KIAA0102 GT:DATABASE huge2038 LENGTH 225 SQ:AASEQ AAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIK SW:ID SPCS2_PONAB SW:DE RecName: Full=Signal peptidase complex subunit 2; EC=3.4.-.-;AltName: Full=Microsomal signal peptidase 25 kDa subunit; Short=SPase 25 kDa subunit; SW:GN Name=SPCS2; SW:KW Acetylation; Endoplasmic reticulum; Hydrolase; Membrane; Microsome;Protease; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 31->225|SPCS2_PONAB|e-113|100.0|195/226| GO:SWS:NREP 6 GO:SWS GO:0005783|"GO:endoplasmic reticulum"|Endoplasmic reticulum| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0005792|"GO:microsome"|Microsome| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 2 TM:REGION 82->104| TM:REGION 112->133| SEG 1->30|aaaavqggrsggsggcsgaggasncgtgsg| RP:PFM:NREP 1 RP:PFM:REP 55->218|PF06703|1e-35|48.7|158/159|SPC25| HM:PFM:NREP 1 HM:PFM:REP 54->217|PF06703|2e-55|41.9|160/161|SPC25| GO:PFM:NREP 4 GO:PFM GO:0005787|"GO:signal peptidase complex"|PF06703|IPR009582| GO:PFM GO:0006465|"GO:signal peptide processing"|PF06703|IPR009582| GO:PFM GO:0008233|"GO:peptidase activity"|PF06703|IPR009582| GO:PFM GO:0016021|"GO:integral to membrane"|PF06703|IPR009582| OP:NHOMO 101 OP:NHOMOORG 81 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----1-1-----111--------------------------------11-------1----------------------------------------------1-1-1--21211111112211111311A21121111111111111111111-1111111111111111111----------12122-1-1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,177-186,220-226| PSIPRED ccccccccccccccccccccccccccccccccHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccEEEEEEEEcccccccEEEEEEEEcccccccEEEEEEEEHHHEEccccEEEccHHHHHHHHHHHHHHcccccc //