[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0107
DDBJ      :             KIAA0107
Swiss-Prot:PSMD6_HUMAN  RecName: Full=26S proteasome non-ATPase regulatory subunit 6;AltName: Full=26S proteasome regulatory subunit S10;AltName: Full=p42A;AltName: Full=Proteasome regulatory particle subunit p44S10;AltName: Full=Phosphonoformate immuno-associated protein 4;AltName: Full=Breast cancer-associated protein SGA-113M;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
a.118.8a.4.5
:397 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   154->241 2b7mA PDBj 6e-04 31.8 %
:RPS:PDB   204->373 3chmA PDBj 2e-23 9.6 %
:RPS:SCOP  301->374 1ufmA  a.4.5.47 * 8e-16 19.7 %
:HMM:SCOP  89->209 1qqeA_ a.118.8.1 * 0.00089 24.6 %
:HMM:SCOP  292->375 1ufmA_ a.4.5.47 * 1.9e-21 33.3 %
:RPS:PFM   102->245 PF10602 * RPN7 4e-33 43.1 %
:RPS:PFM   243->339 PF10388 * YkuI_C 2e-04 28.9 %
:RPS:PFM   314->366 PF01399 * PCI 3e-06 41.5 %
:HMM:PFM   74->247 PF10602 * RPN7 2.7e-65 46.0 174/177  
:HMM:PFM   262->365 PF01399 * PCI 5.4e-19 25.0 104/105  
:BLT:SWISS 9->397 PSMD6_HUMAN 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0107 GT:ORG huge0 GT:GENE KIAA0107 GT:PRODUCT KIAA0107 GT:DATABASE huge2038 LENGTH 397 SQ:AASEQ SAAVPLAAMPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM SW:ID PSMD6_HUMAN SW:DE RecName: Full=26S proteasome non-ATPase regulatory subunit 6;AltName: Full=26S proteasome regulatory subunit S10;AltName: Full=p42A;AltName: Full=Proteasome regulatory particle subunit p44S10;AltName: Full=Phosphonoformate immuno-associated protein 4;AltName: Full=Breast cancer-associated protein SGA-113M; SW:GN Name=PSMD6; Synonyms=KIAA0107, PFAAP4; SW:KW Complete proteome; Proteasome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 9->397|PSMD6_HUMAN|0.0|100.0|389/389| GO:SWS:NREP 1 GO:SWS GO:0000502|"GO:proteasome complex"|Proteasome| SEG 86->100|edelkrldeeledae| BL:PDB:NREP 1 BL:PDB:REP 154->241|2b7mA|6e-04|31.8|88/500| RP:PDB:NREP 1 RP:PDB:REP 204->373|3chmA|2e-23|9.6|156/161| RP:PFM:NREP 3 RP:PFM:REP 102->245|PF10602|4e-33|43.1|144/174|RPN7| RP:PFM:REP 243->339|PF10388|2e-04|28.9|97/155|YkuI_C| RP:PFM:REP 314->366|PF01399|3e-06|41.5|53/104|PCI| HM:PFM:NREP 2 HM:PFM:REP 74->247|PF10602|2.7e-65|46.0|174/177|RPN7| HM:PFM:REP 262->365|PF01399|5.4e-19|25.0|104/105|PCI| RP:SCP:NREP 1 RP:SCP:REP 301->374|1ufmA|8e-16|19.7|71/84|a.4.5.47| HM:SCP:REP 89->209|1qqeA_|0.00089|24.6|114/290|a.118.8.1|1/1|TPR-like| HM:SCP:REP 292->375|1ufmA_|1.9e-21|33.3|84/0|a.4.5.47|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 356 OP:NHOMOORG 195 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1111221-311122211111111111111111121211111111111111112112221121111111111111111-1111111112-1211112111121121312224232242122-12241232BO312361211212211221221112322223322232223611221221A2121243441321132221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 52.9 SQ:SECSTR #########################################################################################################################################################HHHHHHHHHHHHHHHHHTcHHHHHTTHHHHHHHHHHHHHHHHTHHHHHHHccHHHHHHHHHHHHTTccGGHHHGHHHHHHHHHHcHTTccccHHHHTcHHHHTTTTcTHHHHHHHHHHHHccHHHHHHHGGGccccc##########HHHHHHHHHHHHHHHHHHccEEEHHHHHHHHTcccHHHHHHHHTHHHHTcEEEEEETTTTEEEEEEEccTTcc######################## DISOP:02AL 1-3,179-179| PSIPRED ccccccHHccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccHHHHHHHHHHHHHcccccEEEEccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //