[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA0621
DDBJ      :             KIAA0621
Swiss-Prot:RHG26_HUMAN  RecName: Full=Rho GTPase-activating protein 26;AltName: Full=Rho-type GTPase-activating protein 26;AltName: Full=Oligophrenin-1-like protein;AltName: Full=GTPase regulator associated with focal adhesion kinase;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
a.116.1a.238.1b.34.2b.55.1
:753 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->300 2elbA PDBj 2e-05 22.3 %
:BLT:PDB   322->512 1f7cA PDBj 1e-94 96.2 %
:BLT:PDB   693->753 1ugvA PDBj 4e-32 98.4 %
:RPS:PDB   22->280 1efyA PDBj 9e-36 14.5 %
:RPS:PDB   331->513 2ee4A PDBj 1e-38 25.7 %
:RPS:PDB   693->753 2dlmA PDBj 1e-13 26.7 %
:RPS:SCOP  1->217 2elbA1  a.238.1.1 * 7e-38 18.0 %
:RPS:SCOP  194->303 1ki1B2  b.55.1.1 * 4e-12 11.8 %
:RPS:SCOP  322->512 1f7cA  a.116.1.1 * 7e-36 94.0 %
:RPS:SCOP  685->751 1ov3A2  b.34.2.1 * 9e-16 22.7 %
:HMM:SCOP  8->193 1y2oA1 a.238.1.3 * 7.8e-43 37.4 %
:HMM:SCOP  198->315 1wjmA_ b.55.1.1 * 5.4e-14 25.9 %
:HMM:SCOP  322->512 1f7cA_ a.116.1.1 * 5.5e-52 37.2 %
:HMM:SCOP  591->753 1udlA_ b.34.2.1 * 2.6e-14 36.0 %
:RPS:PFM   208->307 PF00169 * PH 2e-04 34.1 %
:RPS:PFM   331->482 PF00620 * RhoGAP 5e-31 39.2 %
:RPS:PFM   701->751 PF07653 * SH3_2 2e-06 42.0 %
:HMM:PFM   331->481 PF00620 * RhoGAP 9.5e-44 37.8 148/153  
:HMM:PFM   701->746 PF00018 * SH3_1 2.3e-10 46.7 45/48  
:HMM:PFM   23->156 PF08397 * IMD 1.5e-05 25.4 134/219  
:HMM:PFM   446->584 PF05073 * Baculo_p24 0.0006 27.0 100/182  
:BLT:SWISS 1->753 RHG26_HUMAN 0.0 100.0 %
:PROS 704->710|PS00290|IG_MHC
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA0621 GT:ORG huge0 GT:GENE KIAA0621 GT:PRODUCT KIAA0621 GT:DATABASE huge2038 LENGTH 753 SQ:AASEQ DSLNEFKFQCIGDAETDDEMCIARSLQEFATVLRNLEDERIRMIENASEVLITPLEKFRKEQIGAAKEAKKKYDKETEKYCGILEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLEYVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFGDFKTQLTISIQNTRNRFEGTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITMVPFDQKSGGKGGEDESVILKSCTRRKTDSIEKRFCFDVEAVDRPGVITMQALSEEDRRLWMEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQGLYRIVGVNSRVQKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLENQESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVRSVAGFVWFSVAAVVLSLARSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL SW:ID RHG26_HUMAN SW:DE RecName: Full=Rho GTPase-activating protein 26;AltName: Full=Rho-type GTPase-activating protein 26;AltName: Full=Oligophrenin-1-like protein;AltName: Full=GTPase regulator associated with focal adhesion kinase; SW:GN Name=ARHGAP26; Synonyms=GRAF, KIAA0621, OPHN1L; SW:KW 3D-structure; Alternative splicing; Cell junction;Chromosomal rearrangement; Complete proteome; Cytoplasm; Cytoskeleton;Disease mutation; GTPase activation; Proto-oncogene; SH3 domain. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->753|RHG26_HUMAN|0.0|100.0|753/814| GO:SWS:NREP 4 GO:SWS GO:0030054|"GO:cell junction"|Cell junction| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005856|"GO:cytoskeleton"|Cytoskeleton| GO:SWS GO:0005096|"GO:GTPase activator activity"|GTPase activation| PROS 704->710|PS00290|IG_MHC|PDOC00262| TM:NTM 1 TM:REGION 644->666| SEG 65->79|aakeakkkydketek| SEG 523->536|srkkssdskppscs| SEG 556->587|nsiinsslesvssnpnsilnsssslqpnmnss| SEG 596->640|ptrpnslppnpsptsplspswpmfsapsspmptsstssdsspvrs| BL:PDB:NREP 3 BL:PDB:REP 22->300|2elbA|2e-05|22.3|251/337| BL:PDB:REP 322->512|1f7cA|1e-94|96.2|182/182| BL:PDB:REP 693->753|1ugvA|4e-32|98.4|61/72| RP:PDB:NREP 3 RP:PDB:REP 22->280|1efyA|9e-36|14.5|241/350| RP:PDB:REP 331->513|2ee4A|1e-38|25.7|179/209| RP:PDB:REP 693->753|2dlmA|1e-13|26.7|60/68| RP:PFM:NREP 3 RP:PFM:REP 208->307|PF00169|2e-04|34.1|88/102|PH| RP:PFM:REP 331->482|PF00620|5e-31|39.2|148/152|RhoGAP| RP:PFM:REP 701->751|PF07653|2e-06|42.0|50/53|SH3_2| HM:PFM:NREP 4 HM:PFM:REP 331->481|PF00620|9.5e-44|37.8|148/153|RhoGAP| HM:PFM:REP 701->746|PF00018|2.3e-10|46.7|45/48|SH3_1| HM:PFM:REP 23->156|PF08397|1.5e-05|25.4|134/219|IMD| HM:PFM:REP 446->584|PF05073|0.0006|27.0|100/182|Baculo_p24| GO:PFM:NREP 2 GO:PFM GO:0005622|"GO:intracellular"|PF00620|IPR000198| GO:PFM GO:0007165|"GO:signal transduction"|PF00620|IPR000198| RP:SCP:NREP 4 RP:SCP:REP 1->217|2elbA1|7e-38|18.0|194/258|a.238.1.1| RP:SCP:REP 194->303|1ki1B2|4e-12|11.8|110/132|b.55.1.1| RP:SCP:REP 322->512|1f7cA|7e-36|94.0|182/182|a.116.1.1| RP:SCP:REP 685->751|1ov3A2|9e-16|22.7|66/69|b.34.2.1| HM:SCP:REP 8->193|1y2oA1|7.8e-43|37.4|179/0|a.238.1.3|1/1|BAR/IMD domain-like| HM:SCP:REP 198->315|1wjmA_|5.4e-14|25.9|116/0|b.55.1.1|1/1|PH domain-like| HM:SCP:REP 322->512|1f7cA_|5.5e-52|37.2|191/191|a.116.1.1|1/1|GTPase activation domain, GAP| HM:SCP:REP 591->753|1udlA_|2.6e-14|36.0|89/0|b.34.2.1|1/1|SH3-domain| OP:NHOMO 3559 OP:NHOMOORG 166 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----JEF-----5663342434444443323333333333233323334443334443432342222233333333524423331344-56436535453455GHE-L-AQ*****zWOPMSkU**O*K***I*l*OWUPvQdscHdRQQuHH*WnehjHUcLIGPAPCDZDKGC-----------14-3--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 592 STR:RPRED 78.6 SQ:SECSTR HHHHHHHHHHHHHHHTcccHHccHHHHHHHHHHTcHHHHHHHHHHTTccTTTccGGGccHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHTTccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHEEcHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHTcEEEEccTTcHHHHHHHHHHHHTccGGGccEEEEEEEEEEEEETGGGGGcccEEEEEEEEcGGGHHHcTTccGGGcTTcccEccHHHHHGGGcccccccEEEEEEEEEHHHHHHHGGGccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHTccccTTTTTccccHHHHHHHHHHHHHcTTccHHHHTTTcGccHHHHHHHHHHHHHHcccccccTTTHHHHHHHHccccHHHHHHHHHHHTTTccTTHHHHHHHHHHHHHHHHHTHHHHcccHHHHHHHHHHHHccccccccccccccTTHHHHHHHHHHTHHHHTTcccccEEEEccc#################################################################################################################################################################cEccccccccccccccccEEEccccccccccccccccccEEEEEEEEETTEEEEEEETTEEEEEEcccEEcc DISOP:02AL 1-1,88-99,173-210,242-256,260-260,263-269,287-305,516-698,705-705| PSIPRED ccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEcccccccccccccEEEEEEccccEEEEEEccccccccccccccccccccccccccccccccccEEEEEccccEEEEEcccHHHHHHHHHcccccccccccccHHHHccccccccccHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccEEEEccccccccEEEEEEccEEcccccccEEEc //