[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA1150
DDBJ      :             KIAA1150
Swiss-Prot:P66B_HUMAN   RecName: Full=Transcriptional repressor p66-beta;AltName: Full=p66/p68;AltName: Full=GATA zinc finger domain-containing protein 2B;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  57/199 : Viruses  0/175   --->[See Alignment]
g.39.1
:499 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   302->350 2egqA PDBj 5e-04 20.0 %
:RPS:PDB   322->368 3dfxA PDBj 2e-09 23.4 %
:RPS:SCOP  320->350 1gatA  g.39.1.1 * 5e-06 29.0 %
:HMM:SCOP  320->350 2gatA_ g.39.1.1 * 1.5e-05 35.5 %
:HMM:PFM   326->359 PF00320 * GATA 4.6e-11 38.2 34/36  
:BLT:SWISS 1->499 P66B_HUMAN 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA1150 GT:ORG huge0 GT:GENE KIAA1150 GT:PRODUCT KIAA1150 GT:DATABASE huge2038 LENGTH 499 SQ:AASEQ PGKENINDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLRDELRLEEARLVLLKKLRQSQLQKENVVQKTPVVQNAASIVQPSPAHVGQQGLSKLPSRPGAQGVEPQNLRTLQGHSVIRSATNTTLPHMLMSQRVIAPNPAQLQGQRGPPKPGLVRTTTPNMNPAINYQPQSSSSVPCQRTTSSAIYMNLASHIQPGTVNRVSSPLPSPSAMTDAANSQAAAKLALRKQLEKTLLEIPPPKPPAPLLHFLPSAANSEFIYMVGLEEVVQSVIDSQGKSCASLLRVEPFVCAQCRTDFTPHWKQEKNGKILCEQCMTSNQKKALKAEHTNRLKNAFVKALQQEQEIEQRLQQQAALSPTTAPAVSSVSKQETIMRHHTLRQAPQPQSSLQRGIPTSARSMLSNFAQAPQLSVPGGLLGMPGVNIAYLNTGIGGHKGPSLADRQREYLLDMIPPRSISQSISGQK SW:ID P66B_HUMAN SW:DE RecName: Full=Transcriptional repressor p66-beta;AltName: Full=p66/p68;AltName: Full=GATA zinc finger domain-containing protein 2B; SW:GN Name=GATAD2B; Synonyms=KIAA1150; SW:KW Coiled coil; Complete proteome; Metal-binding; Nucleus;Phosphoprotein; Repressor; Transcription; Transcription regulation;Zinc; Zinc-finger. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->499|P66B_HUMAN|0.0|100.0|499/593| GO:SWS:NREP 4 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0005634|"GO:nucleus"|Nucleus| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| SEG 35->51|sdneassprsssrmeer| SEG 75->99|lrdelrleearlvllkklrqsqlqk| SEG 251->266|aansqaaaklalrkql| SEG 270->287|lleipppkppapllhflp| SEG 374->391|alqqeqeieqrlqqqaal| RP:PDB:NREP 2 RP:PDB:REP 302->350|2egqA|5e-04|20.0|45/77| RP:PDB:REP 322->368|3dfxA|2e-09|23.4|47/58| HM:PFM:NREP 1 HM:PFM:REP 326->359|PF00320|4.6e-11|38.2|34/36|GATA| RP:SCP:NREP 1 RP:SCP:REP 320->350|1gatA|5e-06|29.0|31/60|g.39.1.1| HM:SCP:REP 320->350|2gatA_|1.5e-05|35.5|31/66|g.39.1.1|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 131 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------13333212121222321328G2131422222222221222211422212---1311-31-2--1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 63 STR:RPRED 12.6 SQ:SECSTR #############################################################################################################################################################################################################################################################################################################cccccEEEETTEEE####ccTTcccTTTcccccccccccTTcccccHHHHHHHHHHcccccGGGccc################################################################################################################################### DISOP:02AL 1-3,5-5,10-29,36-49,98-142,146-164,173-190,208-256,314-318,384-447,493-500| PSIPRED cccccccccccccHHHHHHHHcccccccccEEEEccccccccccccccEEEEHHccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccHHccccccccccccEEEEccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEcccccccccccEEcccccEEHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccHHHcccccccccccHHHHHHHHHHHHccccccccccccccc //