[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA1165
DDBJ      :             KIAA1165
Swiss-Prot:NFIP2_HUMAN  RecName: Full=NEDD4 family-interacting protein 2;AltName: Full=NEDD4 WW domain-binding protein 5A;AltName: Full=Putative MAPK-activating protein PM04/PM05/PM06/PM07;AltName: Full=Putative NF-kappa-B-activating protein 413;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  56/199 : Viruses  0/175   --->[See Alignment]
:284 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   165->230 PF10176 * DUF2370 8e-10 42.4 %
:HMM:PFM   121->231 PF10176 * DUF2370 2e-36 35.5 93/232  
:HMM:PFM   238->278 PF10176 * DUF2370 4.7e-12 34.1 41/232  
:BLT:SWISS 13->284 NFIP2_HUMAN e-131 99.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA1165 GT:ORG huge0 GT:GENE KIAA1165 GT:PRODUCT KIAA1165 GT:DATABASE huge2038 LENGTH 284 SQ:AASEQ DRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAVSSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL SW:ID NFIP2_HUMAN SW:DE RecName: Full=NEDD4 family-interacting protein 2;AltName: Full=NEDD4 WW domain-binding protein 5A;AltName: Full=Putative MAPK-activating protein PM04/PM05/PM06/PM07;AltName: Full=Putative NF-kappa-B-activating protein 413; SW:GN Name=NDFIP2; Synonyms=KIAA1165, N4WBP5A; SW:KW Complete proteome; Endosome; Golgi apparatus; Membrane; Polymorphism;Transmembrane; Ubl conjugation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 13->284|NFIP2_HUMAN|e-131|99.6|272/336| GO:SWS:NREP 4 GO:SWS GO:0005768|"GO:endosome"|Endosome| GO:SWS GO:0005794|"GO:Golgi apparatus"|Golgi apparatus| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 3 TM:REGION 179->201| TM:REGION 210->232| TM:REGION 239->261| SEG 136->151|eaekakaaamaaaaae| SEG 180->191|ifmlaffmafif| SEG 242->256|wlwwiflvlglllff| RP:PFM:NREP 1 RP:PFM:REP 165->230|PF10176|8e-10|42.4|66/169|DUF2370| HM:PFM:NREP 2 HM:PFM:REP 121->231|PF10176|2e-36|35.5|93/232|DUF2370| HM:PFM:REP 238->278|PF10176|4.7e-12|34.1|41/232|DUF2370| OP:NHOMO 134 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------343532222-232332226F2123221222222422222221423222----1111111---11------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14,18-47,57-94| PSIPRED cccccccccccccccccccHHHHHHHccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccHHHccccccccccEEEccccccccccccccccccccccccccccccHHHHHHcHHHHHccccccccccccccccccccccccHHEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEc //