[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA1180
DDBJ      :             KIAA1180
Swiss-Prot:NDRG4_HUMAN  RecName: Full=Protein NDRG4;AltName: Full=Brain development-related molecule 1;AltName: Full=Vascular smooth muscle cell-associated protein 8;         Short=SMAP-8;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  75/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:360 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->293 2qmqA PDBj 1e-99 65.6 %
:RPS:PDB   59->236 2apjA PDBj 3e-22 13.2 %
:RPS:SCOP  9->292 1ehyA  c.69.1.11 * 4e-15 13.8 %
:HMM:SCOP  16->293 1c4xA_ c.69.1.10 * 4.4e-25 22.3 %
:RPS:PFM   19->297 PF03096 * Ndr 7e-99 63.3 %
:HMM:PFM   16->297 PF03096 * Ndr 8.6e-127 52.7 275/283  
:BLT:SWISS 9->360 NDRG4_HUMAN 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA1180 GT:ORG huge0 GT:GENE KIAA1180 GT:PRODUCT KIAA1180 GT:DATABASE huge2038 LENGTH 360 SQ:AASEQ RRVPSLGKMPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIAYLKDRRLSGGAVPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTMEVSC SW:ID NDRG4_HUMAN SW:DE RecName: Full=Protein NDRG4;AltName: Full=Brain development-related molecule 1;AltName: Full=Vascular smooth muscle cell-associated protein 8; Short=SMAP-8; SW:GN Name=NDRG4; Synonyms=BDM1, KIAA1180; SW:KW Alternative splicing; Complete proteome; Developmental protein;Phosphoprotein. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 9->360|NDRG4_HUMAN|0.0|100.0|352/352| GO:SWS:NREP 1 GO:SWS GO:0007275|"GO:multicellular organismal development"|Developmental protein| TM:NTM 1 TM:REGION 120->142| SEG 115->127|yvigigvgagayv| SEG 316->331|trlarsrtasltsass| BL:PDB:NREP 1 BL:PDB:REP 17->293|2qmqA|1e-99|65.6|273/278| RP:PDB:NREP 1 RP:PDB:REP 59->236|2apjA|3e-22|13.2|167/243| RP:PFM:NREP 1 RP:PFM:REP 19->297|PF03096|7e-99|63.3|270/277|Ndr| HM:PFM:NREP 1 HM:PFM:REP 16->297|PF03096|8.6e-127|52.7|275/283|Ndr| RP:SCP:NREP 1 RP:SCP:REP 9->292|1ehyA|4e-15|13.8|268/282|c.69.1.11| HM:SCP:REP 16->293|1c4xA_|4.4e-25|22.3|260/0|c.69.1.10|1/1|alpha/beta-Hydrolases| OP:NHOMO 440 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----11--------------------------------------------------------------------------------------------------------2AA7A9744434449B4D4V*D2F5B2443A444324345643C43344--132223D2442222-----2111-7434-31------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 81.9 SQ:SECSTR cccTTccccGGGccEcEEEEETTEEEEEEEEccTccccccEEEEccTTccGHHHHGGGTEEEcTTTHTccEEEcccccGGGccTTcccTTEEEEcTTccEEEccccTTTTTcTTcccccccHHHHHHHHHHHHTcTTccEEEEEEEEcEcccTTccGGGGcTTcHHGGGccEEEEEEEEccGGcccHHHHHHHHHHHHHHHHHTTcTTccEEEEEcccccTTHHHHHHHHHHcccTEEEEEEEEcccccHHHHHHHHHHcTTEEEEEEEEEcccGGGTcHHHHHHHHHHHGGGGc################################################################# DISOP:02AL 1-4,300-361| PSIPRED ccccccccccccccccEEEEcccEEEEEEEEEcccccccEEEEEccccccHHHHHHHHcccHHHHHHHcccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHHHHHcEEEEEccccccHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccHHHHHccccEEEEEccccccHHHHHHHHHHcccccEEEEEEccccccccHHcHHHHHHHHHHHHHHccccccccccccccccccHHccHHHcccccccccccccccccccccccccccccccccccccccccc //