[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Homo sapiens (cDNA) (huge0)
Gene : KIAA1883
DDBJ      :             KIAA1883
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  79/915 : Eukaryota  196/199 : Viruses  1/175   --->[See Alignment]
d.144.1
:1480 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   148->420 1irkA PDBj 4e-44 38.7 %
:RPS:PDB   148->422 2bmcF PDBj 5e-37 19.4 %
:RPS:PDB   404->432 3bprA PDBj 5e-05 55.2 %
:RPS:SCOP  150->427 1nw1A  d.144.1.8 * 2e-34 11.2 %
:HMM:SCOP  138->448 1ir3A_ d.144.1.7 * 1.8e-60 30.4 %
:RPS:PFM   158->424 PF07714 * Pkinase_Tyr 9e-42 40.1 %
:HMM:PFM   154->427 PF07714 * Pkinase_Tyr 2.5e-65 36.6 254/259  
:BLT:SWISS 21->757,869->1245,1346->1462 LMTK3_HUMAN 0.0 100.0 %
:PROS 159->184|PS00107|PROTEIN_KINASE_ATP
:PROS 282->294|PS00109|PROTEIN_KINASE_TYR
:TM
:REPEAT 2|949->992|994->1037
:SEG

SeqInfo AminoSeq See neighboring genes
Links HUGE Abbreviations Back to title page
GT:ID KIAA1883 GT:ORG huge0 GT:GENE KIAA1883 GT:PRODUCT KIAA1883 GT:DATABASE huge2038 LENGTH 1480 SQ:AASEQ VCVTARETRHHLHLPAILDKMPAPGALILLAAVSASGCLASPAHPDGFALGRAPLAPPYAVVLISCSGLLAFIFLLLTCLCCKRGDVGFKEFENPEGEDCSGEYTPPAEETSSSQSLPDVYILPLAEVSLPMPAPQPSHSDMTTPLGLSRQHLSYLQEIGSGWFGKVILGEIFSDYTPAQVVVKELRASAGPLEQRKFISEAQPYRSLQHPNVLQCLGLCVETLPFLLIMEFCQLGDLKRYLRAQRPPEGLSPELPPRDLRTLQRMGLEIARGLAHLHSHNYVHSDLALRNCLLTSDLTVRIGDYGLAHSNYKEDYYLTPERLWIPLRWAAPELLGELHGTFMVVDQSRESNIWSLGVTLWELFEFGAQPYRHLSDEEVLAFVVRQQHVKLARPRLKLPYADYWYDILQSCWRPPAQRPSASDLQLQLTYLLSERPPRPPPPPPPPRDGPFPWPWPPAHSAPRPGTLSSPFPLLDGFPGADPDDVLTVTESSRGLNLECLWEKARRGAGRGGGAPAWQPASAPPAPHANPSNPFYEALSTPSVLPVISARSPSVSSEYYIRLEEHGSPPEPLFPNDWDPLDPGVPAPQAPQAPSEVPQLVSETWASPLFPAPRPFPAQSSASGSFLLSGWDPEGRGAGETLAGDPAEVLGERGTAPWVEEEEEEEEGSSPGEDSSSLGGGPSRRGPLPCPLCSREGACSCLPLERGDAVAGWGGHPALGCPHPPEDDSSLRAERGSLADLPMAPPASAPPEFLDPLMGAAAPQYPGRGPPPAPPPPPPPPRAPADPAASPDPPSAVASPGSGLSSPGPKPGDSGYETETPFSPEGAFPGGGAAEEEGVPRPRAPPEPPDPGAPRPPPDPGPLPLPGPREKPTFVVQVSTEQLLMSLREDVTRNLLGEKGATARETGPRKAGRGPGNREKVPGLNRDPTVLGNGKQAPSLSLPVNGVTVLENGDQRAPGIEEKAAENGALGSPEREEKVLENGELTPPRREEKALENGELRSPEAGEKVLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPGTERRAPETGGAPRAPGAGRLDLGSGGRAPVGTGTAPGGGPGSGVDAKAGWVDNTRPQPPPPPLPPPPEAQPRRLEPAPPRARPEVAPEGEPGAPDSRAGGDTALSGDGDPPKPERKGPEMPRLFLDLGPPQGNSEQIKARLSRLSLALPPLTLTPFPGPGPRRPPWEGADAGAAGGEAGGAGAPGPAEEDGEDEDEDEEEDEEAAAPGAAAGPRGPGRARAAPVPVVVSSADADAARPLRGLLKSPRGADEPEDSELERKRKMVSFHGDVTVYLFDQETPTNELSVQAPPEGDTDPSTPPAPPTPPHPATPGDGFPSNDSGFGGSFEWAEDFPLLPPPGPPLCFSRFSVSPALETPGPPARAPDARPAGPVEN BL:SWS:NREP 1 BL:SWS:REP 21->757,869->1245,1346->1462|LMTK3_HUMAN|0.0|100.0|1231/1460| PROS 159->184|PS00107|PROTEIN_KINASE_ATP|PDOC00100| PROS 282->294|PS00109|PROTEIN_KINASE_TYR|PDOC00100| TM:NTM 2 TM:REGION 21->43| TM:REGION 57->79| NREPEAT 1 REPEAT 2|949->992|994->1037| SEG 69->82|llafifllltclcc| SEG 435->464|rpprpppppppprdgpfpwpwppahsaprp| SEG 504->533|arrgagrgggapawqpasappaphanpsnp| SEG 585->593|papqapqap| SEG 659->692|eeeeeeeegsspgedssslgggpsrrgplpcplc| SEG 758->814|gaaapqypgrgpppapppppppprapadpaaspdppsavaspgsglsspgpkpgdsg| SEG 820->868|pfspegafpgggaaeeegvprprappeppdpgaprpppdpgplplpgpr| SEG 1110->1126|rrapetggaprapgagr| SEG 1132->1156|ggrapvgtgtapgggpgsgvdakag| SEG 1162->1201|rpqppppplppppeaqprrlepapprarpevapegepgap| SEG 1246->1272|arlsrlslalppltltpfpgpgprrpp| SEG 1274->1345|egadagaaggeaggagapgpaeedgedededeeedeeaaapgaaagprgpgraraapvpvvvssadadaarp| SEG 1400->1418|dtdpstppapptpphpatp| SEG 1440->1449|pllpppgppl| SEG 1463->1477|pgpparapdarpagp| BL:PDB:NREP 1 BL:PDB:REP 148->420|1irkA|4e-44|38.7|261/303| RP:PDB:NREP 2 RP:PDB:REP 148->422|2bmcF|5e-37|19.4|253/257| RP:PDB:REP 404->432|3bprA|5e-05|55.2|29/261| RP:PFM:NREP 1 RP:PFM:REP 158->424|PF07714|9e-42|40.1|242/254|Pkinase_Tyr| HM:PFM:NREP 1 HM:PFM:REP 154->427|PF07714|2.5e-65|36.6|254/259|Pkinase_Tyr| GO:PFM:NREP 3 GO:PFM GO:0004672|"GO:protein kinase activity"|PF07714|IPR001245| GO:PFM GO:0005524|"GO:ATP binding"|PF07714|IPR001245| GO:PFM GO:0006468|"GO:protein amino acid phosphorylation"|PF07714|IPR001245| RP:SCP:NREP 1 RP:SCP:REP 150->427|1nw1A|2e-34|11.2|258/365|d.144.1.8| HM:SCP:REP 138->448|1ir3A_|1.8e-60|30.4|299/303|d.144.1.7|1/1|Protein kinase-like (PK-like)| OP:NHOMO 13205 OP:NHOMOORG 277 OP:PATTERN ---------------------------------------------------------3---------- 1---11----------------------------------------------------------------------11----2-------------1---------------------1---------------------1---111-1-11--------------2-------------------11-1--1-11111111111111------11111-1---------1--1------------------1-1---1--11-----111---------------1111111-111111-------1---1-----------------------------------------111---11---1---1------1-----------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------1-----------------------------------------------1--2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------1------------------------------ 5-66ru*-gJ96CHG4956858576756556265696A7A78A66844625568356598883995571646A8967678787A88CA-DIA9BDC6559567JGE3*JX**********************F************w******e*************e*nt****b5jVE*BD9dL****7**44****5 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------3---- STR:NPRED 347 STR:RPRED 23.4 SQ:SECSTR #######################################################################################GGTTccGGGEEETHHHHHHHHHHcGGGccccTTccHHHHHHHHcEEEEEcGGGcEEcccTccGGGEEEEEEEEEcccEEEEEEEETTTccEEEEEEEEHHHHHHTTcHHHHHHHHHHHTTcccTTcccEEEEEEcccEEEEEEcccTTccHHHHHHHHcccTccHccTTTccHHHHHHHHHHHHHHHHHHHTTTcEEccccGGGEEEcTTccEEEccccEccEccGGGccHHHHGGGTccTTHHHHHHHHHHHHHHHccEcHHHHHcTTccccHHHHHHHHHTTcccccTTccHHHHHHHHHHccccGGGccccHcHHHHHHcHHHHHcccccccHHHHHHHHHHHH###################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################################### DISOP:02AL 1-3,5-7,96-98,101-121,247-256,432-558,567-567,569-584,599-626,647-697,733-737,740-742,796-812,831-864,876-939,949-1009,1011-1245,1257-1258,1311-1332,1356-1367,1391-1431,1452-1475,1477-1481| PSIPRED cccccccccHHccHHHHHHHccccEEEEEEHHHccccHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHEEcccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccHHHEEEEEEEcccccccEEEEEEEccccEEEEEEEEEcccccHHHHHHHHHHHHHHHccccccEEEEEEEEEccccEEEEEcccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcEEEccccEEEEEccccEEccccccEEEEccccEEEEccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccHHccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccHHHcccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccEEEEEcccccccccHHHHcccccccccccHHHHccccEEEEEccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //